[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for rpal2:ABE38168.1

[Show Plain Result]


## Summary of Sequence Search
    1::249
    9::149     4e-18  49%  157 aa  PF01012 ETF "Electron transfer flavoprotein domain"
    1::249

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKMSMNPFDEIAVEEALRLKEAGKATEVVVVSIGPAQASE
PF01012         -------------------------------KGSLNPVDLEALEEARRLAEKLGG-EVTAVVAGPAEAAE


                         .         .         *         .         .         .         .:140
query           TLRTGLAMGADRGILVKAEGTVEPLAVAKILKAIADEEQPGLIILGKQAIDDDSNQTGQMLAALLGWAQA
PF01012         A-RTALAMGADRVVLVEALAGYDPEAYAKALAALIKKEKPDLVLLGATAIGRD---LGPRLAARLGVPQA


                         +         .         .         .         .         *         .:210
query           TFASKLEVEGSDFTVSREVDGGSQTVKLKGPAIVTxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01012         TDVTKLEIDDGKLTVTRPIYGGNETATVKLPAVIT-----------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01012         ---------------------------------------