[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for rpal2:ABE38181.1

[Show Plain Result]


## Summary of Sequence Search
    1::219
   33::122     1e-13  43%  123 aa  PF00005 ABC_tran "ABC transporter"
    1::219

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00005         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxRIGIVLQDFRLLDHMTTYENVALPFRVSGRDESSYRKEVIDLLKWVGLGERMDALPPVLSG
PF00005         ---------RIGYVFQDPALFPHLTVRENIAFGLKNDEKKKKEAKEEILEALERVGLLKFLYRYPHELSG


                         +         .         .         .         .         *         .:210
query           GEKQRAAIARAVIGRPQLLLADEPTxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00005         GQRQRVAIARALIKEPKVLLLDEPT---------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxx
PF00005         ---------