[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for rpal2:ABE38253.1

[Show Plain Result]


## Summary of Sequence Search
    1::540
   14::336     8e-36  37%  338 aa  PF01494 FAD_binding_3 "FAD binding domain"
    1::540

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLSLAIDLAQRGENVVLLDDADRIGEGSRAICF
PF01494         --------------------------------------LALALALARAGIDVTVLERRPDPREDGRAIGL


                         .         .         *         .         .         .         .:140
query           SKRALEVWDRLGVGARMVEKGVVWQVGKIFRRDEMVYQFDLLPETGHKMPAFINLQQYYAEAYLVERVQQ
PF01494         SPRALELLDRLGLWDALLAEGVPPEGMRIFVWDERPLRRADLEDAGG--PPGLVIPRADLERALLEAAEA


                         +         .         .         .         .         *         .:210
query           LPQIDLRWRNKVTALAQHNDHAVLTIETPDGSYRLAADYVVACDGARSALRGMVGAEFAGEVFEDQFLIA
PF01494         LG-VTVRFGTRVVSVEQDDDGVTVTLDGEDGEETVRADLVVGADGAHSAVRRLLGIPFPGEDYDYRAGVL


                         .         .         .         +         .         .         .:280
query           DVRMNAEFPTERWFWFDPPFHSGQSALLHRQPDNVWRIDLQIGADADAAVERLPENVRPRIERMLGNSDF
PF01494         DVVFEADLPDIRWIRFPP---GGGLALLPLE-DGLVRFYVVLPLDPEEA-ERLPEELLAALQEAFGPRDV


                         .         *         .         .         .         .         +:350
query           SFEWISIYKFQCRRMQRFLHERVIFAGDSAHQVSPFGARGANSGLEDGENIAWKLAMVLRGDAPASLLDS
PF01494         EVDWRSAFPLRQRVAERWSKGRVVLVGDAAHAMHPLAGQGANLALEDAANLAWKLAAVLRAD--EALLDT


                         .         .         .         .         *         .         .:420
query           YEIERSQAAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01494         YEAERLAAA-------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01494         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01494         --------------------------------------------------