[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for rpal2:ABE38261.1

[Show Plain Result]


## Summary of Sequence Search
    1::781
   19::519     3e-92  43%  519 aa  PF02738 Ald_Xan_dh_C2 "Molybdopterin-binding domain of aldehyde
    1::97      8e-20  53%  110 aa  PF01315 Ald_Xan_dh_C "Aldehyde oxidase and xanthine dehydrogenase,
    1::781

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxTGKGRYVDDIKILGMTYAHFVRSPHAHAKIKNIDVEAAKAMPGVVDVLTGQ
PF02738         ----------------------------------------------------------------------
PF01315         -------------------TGEARYTDDIPLPGMLYAAFVRSPHAHARIKSIDTSAALALPGVVAVLTAK


                         .         .         *         .         .         .         .:140
query           QIVDDKVGNLICGWAIHSKDGSAMKMGAWPAMAPETVRFVGQAVAVVIAESKNLARDxxxxxxxxxxxxx
PF02738         ----------------------------------------------------------------------
PF01315         DIP-----------GLNNNGGPVPADEPDPVLADDKVRYVGQPVAAVVAETEEAARD-------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVDEAFGKAANVVSFELTNNRLVPNAMEPRAAIADY
PF02738         -----------------------------------VEAAFAEADHVVEAEYRTPRQAHAPMEPHAALAVP
PF01315         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           NSAEEHFTLYTTSQNPHVARLVLSAFYNIAPEHKLRVVAPDVGGGFGSKIFIYPEEMVALWASKKVGRAV
PF02738         DDGR--LTVWSSTQGPHEVRRAVAKALGL-PEEKVRVIVPRVGGGFGKKKQAYPEAVLAALAAKKLGRPV
PF01315         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           KWTGDRSEAFLTDAHGRDHVSKAELAFDADNRMLALRVKTHANFGAYMSLFSSSVPTYLYATLLSGQYNI
PF02738         KLVLDREEDMLATGKRHPFLQRYRAGADKDGKITALDVDVLADGGAYADLSPPVLPRALHA---DGPYDI
PF01315         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           PAIYAEVIGVYTNTTPVDAYRGAGRPEACYLVERLVETAARQLKVDPAELRRKNFITQFPHQTPVIMAYD
PF02738         PNVRVDGRAVYTNTPPAGAYRGFGGPQAAFAIERLMDELARALGMDPVELRRRNLI-QFPYRTPTGQPYD
PF01315         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           IGDFGASLDAALKAADYSXXXXXXXXXXXXXXXXXXXFSCYIEACGIAPSKAVGSLGAGVGLWESAEVRV
PF02738         SGDLPECLD---ELAEYSGWRERREGRAGN--------SWRKRGVGLAPSKYGIGFGAGQA---GALVRI
PF01315         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           NPVGTIEILTGSHSHGQGHETTFAQLVADRLGIPINQVSIVHGDTDKVQFGMGTYGSRSAAVGMSAIFXX
PF02738         YPDGSVTVRTGGTEMGQGHETKLAQIVAEELGIPLDDVRVVEGDTDKVPNGSGTGGSRSTAVSGSAVRKA
PF01315         ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           XXXXXXXXXXXXXHQLEASEGDIVIENGEFKVTGTDKSIALPMVALAAYTAHNLPDGMEPGLKESAFYDP
PF02738         AEKLREKLLKIAAKLLGPAE-DLEFEDGVAAAYGVSVSLS----ALAAYATPP--------------YGP
PF01315         ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           TNFTFPAGAYICELEVDPGTGKTSFVNFVAVDDFGRLINPMIVEGQVHGGLVQGIGQALLENAIYDETGQ
PF02738         PFFTFPFGAHVAEVEVDPLTGEVRVLRVVAVHDCGRVINPAIVEGQIEGGFVQGIGWALMEELVYDD-GR
PF01315         ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           LVTASFMDYAMPRADDxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02738         LLTANFADYKIPTAAD------------------------------------------------------
PF01315         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           xxxxxxxxxxx
PF02738         -----------
PF01315         -----------