[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for rpal2:ABE38351.1

[Show Plain Result]


## Summary of Sequence Search
    1::440
   26::165     3e-10  38%  273 aa  PF00150 Cellulase "Cellulase (glycosyl hydrolase family 5)"
    1::440

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00150         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxIVAAGFNAVRIPWTDIGLNAPLNGYSDRLGWINITLNPELLASSTPNSQGRYQYVT
PF00150         --------------IAAAGFNTVRLP----------------VGW-------EALEPASGPGVYDPEYLQ


                         +         .         .         .         .         *         .:210
query           TLVAFQRIVDYAQEIGLKVIFNHHTNQGTAGQQRNGLWFDLGPGTDNTDGIVPGRVTAETFKQNWLLVAR
PF00150         RL---DKVVDWAKKYGLYVILDLHNDPGSGWGDPNDAWYT--------------GYNQEAFKAFWRQLAT


                         .         .         .         +         .         .         .:280
query           TFANNPTVIGYDLHNEPNGDRGHITWGGGGPTDIKAMCEDVGSAIQDVSPGVLIICEGPExxxxxxxxxx
PF00150         RYKDDPTVVGFELLNEPRGG------GGNDPDDLKAYYQEAIDAIRAVDPNDHLIVVGGE----------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00150         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00150         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxx
PF00150         --------------------