[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for rpal2:ABE38352.1

[Show Plain Result]


## Summary of Sequence Search
    1::306
    5::172     1e-33  43%  172 aa  PF03808 Glyco_tran_WecB "Glycosyl transferase WecB/TagA/CpsF
    1::306

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03808         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxEADAIHADGMPHVFVSRFKCQT
PF03808         ------------------------------------------------EADLVLPDGIGVVWAARL-LGR


                         +         .         .         .         .         *         .:210
query           PLPERVATTDLFHDVAREASVRGATMFMLGADETSNRLATELVKRRYPKLKLVGRRNGFFADEAEEIAAC
PF03808         PLPERVAGIDLMPALLRRAAKEGKRVFLLGGKPEVLEKAAEKLRERYPGLRIVGTHDGYF-DPEEEEAIV


                         .         .         .         +         .         .         .:280
query           RQIAELAPDILWISMGVPREQVFIRRHRHRLTTVGIIKTSGGLFDFLSGSKARAPQWMQRIGLEWLWRMA
PF03808         ERINASGPDLVFVGLGSPKQEKWIARNRDRLPAIGV----GGSFDFLAGTVKRAPKWMQKLGLEWLYRLL


                         .         *         .         .         .         .         +:350
query           LEPRRLGMRxxxxxxxxxxxxxxxxx
PF03808         SEPKRLWRR-----------------