[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for rpal2:ABE38359.1

[Show Plain Result]


## Summary of Sequence Search
    1::539
    1::123     3e-15  39%  123 aa  PF00005 ABC_tran "ABC transporter"
   95::122     6e-04  36%  123 aa  PF00005 ABC_tran "ABC transporter"(query 428->455)
    1::539

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00005         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xSTLVKTICGLIQPDDGAMRWRXXXXXXXXXXXXXXXXIGLVSQHFALFDNLTVAENVALGQRGGESLDI
PF00005         -STLLRLLAGLLKPTSG----KILLDGVISPLELRKLRIGYVFQDPALFPHLTVRENIAFGLKNDEKLKE
PF00005         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LSRRLAQIAERYGLPLDPKREVWRLSVGERQRIEIVRALMQDPQFLILDEPTAxxxxxxxxxxxxxxxxx
PF00005         IKKKEAEALERVGLLKFLYRYPHELSGGQRQRVAIARALIKEPKVLLLDEPTS-----------------
PF00005         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00005         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00005         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00005         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxLSGGNLQKFIVGREILRQPKLLVVNQPSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00005         ----------------------------------------------------------------------
PF00005         -------LSGGQRQRVAIARALIKEPKVLLLDEPT-----------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00005         -------------------------------------------------
PF00005         -------------------------------------------------