[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for rpal2:ABE38484.1

[Show Plain Result]


## Summary of Sequence Search
    1::489
   81::242     7e-19  42%  242 aa  PF02913 FAD-oxidase_C "FAD linked oxidases, C-terminal domain"
    4::136     1e-16  41%  139 aa  PF01565 FAD_binding_4 "FAD binding domain "
    1::489

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVLR
PF02913         ----------------------------------------------------------------------
PF01565         -------------------------------------------------------------------VVR


                         .         .         *         .         .         .         .:140
query           PGSTAEIAAICKLASETRVALVPQGGNTGLVGGQTPLNGEIVISLKRMDNIREVDTSSNTMTVEAGVILQ
PF02913         ----------------------------------------------------------------------
PF01565         PRSEEEVAAVVKAAREHGLPVVPRGGGHSLLGGAV-VRGGVVIDLSRLNGILEVDPDGLTVTVEAGVTLG


                         +         .         .         .         .         *         .:210
query           HAQERAASVDRLFPLSLGAQGSCTIGGNLSTNXXXXXXXXXXXXRDMALGLEVVLADGRILxxxxxxxxx
PF02913         ----------------------------------------------------------------------
PF01565         DLYAALAPHGLLLPVDPGSGIPGTVGGAVAGNGGGPGSLRYGLTRDNVLGLEVVLADGEIV---------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02913         ----------------------------------------------------------------------
PF01565         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLEAILERGFEEGVVVDAAIATSLTQQQAFWKL
PF02913         --------------------------------------LAAILEAGGAGDVVV----AQDEAERARLWAA
PF01565         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           REEISPAQKPEGGSIKHDVSVPVAAVPQFIDEANAAVVGLIPGARPVPFGHLGDGNIHYNVTQPVDADKA
PF02913         RKAALPAAGRAGPAFTEDVAVPPSRLAELVAEIRALLAK--HGLRVAIFGHAGDGNLHVNIL--FDANDP
PF01565         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           AFLGRWHEVNTVVFAIVMRLGGSISAEHGIGVMKRDELPGVKDQTAIELMRAIKAMLDPQGIMNPGKxx
PF02913         EELARAEAFVDEIVDLVVELGGSISGEHGIGRLKRPYLEEELGPAALDLMRAIKAAFDPNGILNPGK--
PF01565         ---------------------------------------------------------------------