[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for rpal2:ABE38488.1

[Show Plain Result]


## Summary of Sequence Search
    1::339
    1::113     5e-12  43%  128 aa  PF00107 ADH_zinc_N "Zinc-binding dehydrogenase"
    1::339

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00107         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00107         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxGVGVCCVQLAKIAGAYVIACAGSEEKGQRLKEVGADEVILYTKEDFM
PF00107         -----------------------GVGLAAIQLAKALGARVIAVDRSPEKLELAKELGADHVINYKDEDFV


                         .         .         .         +         .         .         .:280
query           QVVRQRHGRPQRVGGGSSENGGVDVVVNFTGGDTWVKSLRTLKLGGRILTCGATAGYDPAEDLRVIWTFE
PF00107         EAVKELTG-----------GRGVDVVLDCVGGATLEAALELLRPGGRVVLVGVPSGGPVTLPLGPLILKE


                         .         *         .         .         .         .         +:350
query           LQVRGSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00107         ITIRGS-----------------------------------------------------