[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for rpal2:ABE38555.1

[Show Plain Result]


## Summary of Sequence Search
    1::467
    1::462     3e-78  44%  462 aa  PF03055 RPE65 "Retinal pigment epithelial membrane protein"
    1::467

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxDNLAPIPMECDAPSLPIKGELPRELNGTLYRNGANPQFASPNAHWFFGDGMLHAFRLEN
PF03055         -----------DSFAPVEEELPPTDLPVTGEIPADLNGTLYRNGPGPLFVGGGGHWFDGDGMLHRFRFKD


                         .         .         *         .         .         .         .:140
query           GRASYRNRWVRTPKWLAEHAAGRPLYGEFNLKLPDAPRSAPDDGNVANTNIVFHAGRLLALEEAHLPIEI
PF03055         GRATYRNRFVRTERYKAERAAGRPIYGEFGTLALDPCKNGLFFGNNANTSVLPHGGRLLALTEAGLPYEI


                         +         .         .         .         .         *         .:210
query           ERDTLATRGYCDYGGALKGPFTAHPKIDPVTGEMLFFGYNAAGPLKRTMSFGAIDASGHVTRFEYFKAPY
PF03055         DPETLETVGRVDFDGQLKGVFTAHPKVDPVTGELYNFGYSL-GP-KPYLTYFVVDADGEVVDVPIFPLPG


                         .         .         .         +         .         .         .:280
query           AAMVHDFIVTENYVLFPILPLTGSIWRAMRGRPPYAWDPGKGSYVGVMKRTGTTRDIRWFRGDACFVFHV
PF03055         PSYMHDFAITENYVVFVDQPLKFDPLKLLKGGSPLKWDPEKPTRFGVIPRRGGKSLVRWFEAPPFFVFHF


                         .         *         .         .         .         .         +:350
query           MNAWEDGTKIVADVMQSEEAPLFTHPDGRRTDPEKGRARLCRWSFDLAGNTNAFKRSYLDDISGEFPRID
PF03055         INAYEEDDEVVVDLCRYDDPDFLNYLDNLRPNYDDSRGRLYRFRLDL--KTGEVRREPLSDRGGEFPRIN


                         .         .         .         .         *         .         .:420
query           ERRAGLRSGHGWYACASPETPMLGMLTGLVHVDGNGHRRARYLLPTGDTIGEPVFVPRKPDSAEADGWLL
PF03055         PRYVGRKYRYVYLAAADPGRKA-GPPDGLVKVDLETGESQVWSFGPGCFPSEPIFVPRPGGTEEDDGYLL


                         .         .         +         .         .         .         .:490
query           TVIWRSCENRSDLAVFNAADIAGGPIALVQLGHRVPDGFHGNWVAAx
PF03055         SVVHDENTGRSELLILDAKTLT-EPVARAELPQRVPYGFHGTWVPA-