[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for rpal2:ABE38556.1

[Show Plain Result]


## Summary of Sequence Search
    1::458
   15::344     9e-21  38%  344 aa  PF09967 DUF2201 "Predicted metallopeptidase (DUF2201)"
    1::458

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVYYGAAFERLPLPEQV
PF09967         ------------------------------------------------------LYYNPAFAKLSPEELV


                         .         .         *         .         .         .         .:140
query           GLVAHEVLHIALRHPQRFVELQRVIGDVDLELFNICADAIVNSTLAHLSWLTLPAKSVMLEQILAKALKR
PF09967         GLLLHEVLHLALRHPLRRKGR-------DPELWNLACDIAVNQYLLEAG-LELPEGAV------------


                         +         .         .         .         .         *         .:210
query           EQEAEAALLEWDVEKLYRAIDDRDTDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
PF09967         ----EEELDGLSAEEIYRRLGGSSQDGGQD----------------------------------------


                         .         .         .         +         .         .         .:280
query           XGARSAKVRELGAGGVRDLVPNPESQSAPEHEAEHAREWSERILRGHAGDGAFSMLRALIADLPHTRTPW
PF09967         -AAEKGKTGSGADGTQADLEPSPAGLDQAEEEQLDARERLARAVEQASERGKLGGLRRLLAELLRPRLDW


                         .         *         .         .         .         .         +:350
query           AQVLRVQLARGLARKPSLTWSRPARSYIANQGRAGQHRMPFEPGFCATKNEPRLALIIDVSGSIDEGLME
PF09967         RQLLRRFLRRAV-RDPDYSYARPNRRY---------PRGLILPGLREEK-LLRLVVAIDTSGSISDEELR


                         .         .         .         .         *         .         .:420
query           RFAREIETITRRQEAGLVLIIGDERVRQVEFFEPGRRFVLSEIEFAGGGGTDFTPLLAEADRHRPDIAVV
PF09967         QFLAEVAGILRATRAEITVIQCDAAVQSVQKLTSED--YLEDLRLKGGGGTDFRPVFEYVDELRPRPAVV


                         .         .         +         .         .         .         .:490
query           LTDLEGPADFKPRWPVIWAVPESHANAVQPFGRLLTLx
PF09967         FTDGEGPPEKKPPYPVLW-VLTGYAEPPVPWGRVVAL-