[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for rpal2:ABE38586.1

[Show Plain Result]


## Summary of Sequence Search
    1::586
    1::169     7e-48  52%  169 aa  PF07167 PhaC_N "Poly-beta-hydroxybutyrate polymerase (PhaC)
   10::40      4e-08  71%   46 aa  PF12551 PHBC_N "Poly-beta-hydroxybutyrate polymerase N terminal"
    2::118     8e-05  36%  213 aa  PF01738 DLH "Dienelactone hydrolase family"
    1::586

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxDRSLHAALAPLTGGLSPTALSLAYADWLSHLxxxxxxxxxxxxxx
PF07167         ----------------------------------------------------------------------
PF12551         -------------------------DRAAHAALARLTGGLSPASLALAYLDWALHL--------------
PF01738         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxPQDRRFAGPEWRQPPFNLMAQSFLLAEEWWRDATTGIRGVSQQNAK
PF07167         ------------------------PKDRRFADPAWQQNPFRFLKQSYLLNAKWLHDAVDDVE-LDPHDRE
PF12551         ----------------------------------------------------------------------
PF01738         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           IVEFAMRQMLDVFAPSNFALTNPEVIRRTLTSEGGNVTAGLRNWWEDLLQTMSHDTDLKHDFEVGRDVAV
PF07167         RVRFAARQLLDALSPSNFLATNPEALKETLETGGESLVRGLENLLEDLERGGKISQTDESAFEVGRNVAT
PF12551         ----------------------------------------------------------------------
PF01738         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           TPGKVVYSNDLIELIQYAPATGEVRPEPILIVPAWIMKYYILDLSPHNSLVKYLTEQGFTVFMVSWRNPT
PF07167         TPGKVVFRNDLIELIQYKPTTEKVHARPLLIVPPWINKYYILDLQPENSLVRYL----------------
PF12551         ----------------------------------------------------------------------
PF01738         ---------------------GALRPAGGGPGPAVVVIHEIFGLNPHRDVADRLAEAGYVVLAPDLRELV


                         .         *         .         .         .         .         +:350
query           AKHRDLTLEDYRRLGVMAAIETIRAIVPHQPIHAVGYCLGGTLLSIAAAAMSRxxxxxxxxxxxxxxxxx
PF07167         ----------------------------------------------------------------------
PF12551         ----------------------------------------------------------------------
PF01738         AKRPEAVLEDLR-----AALDYLRALPEVDPIGVVGFCFGGRLALLLAARDPR-----------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF07167         ----------------------------------------------------------------------
PF12551         ----------------------------------------------------------------------
PF01738         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF07167         ----------------------------------------------------------------------
PF12551         ----------------------------------------------------------------------
PF01738         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF07167         ----------------------------------------------------------------------
PF12551         ----------------------------------------------------------------------
PF01738         ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxx
PF07167         --------------------------
PF12551         --------------------------
PF01738         --------------------------