[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for rpal2:ABE38614.1

[Show Plain Result]


## Summary of Sequence Search
    1::287
    1::162     9e-05  33%  195 aa  PF00528 BPD_transp_1 "Binding-protein-dependent transport system
    1::287

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00528         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxLIAVPINILFGVAAAWTVTKFEFPGRTLLIALIELPYSISPIVAGVAYLFVYGSQGLFGPLLD
PF00528         -------LLAVPLGILLAL-------RRNSRLRRLLRFLVLLPRAIPSLVLALLLLLLFAIGLGGGWILG


                         +         .         .         .         .         *         .:210
query           QLDLKVMFALPGIVLASMFVTAPYVARELIPLMQVQGTDEEEAAVTLGAGGFATFFRVTLPNIRWAMLYG
PF00528         LLGLG--HGLLAVILALVLSTAPFVRLIRRAALESIPKDLIEAARALGASRWQTFRRVILPLALPGIITG


                         .         .         .         +         .         .         .:280
query           AILCNARVLGEFGAVSVVSGNVRGQTTTLPLQIELLYQDYNxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00528         LILAFIGALGEFVIAELLGG---GPGLGSLLLLALLGYDYN-----------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxx
PF00528         -------