[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for rpal2:ABE38720.1

[Show Plain Result]


## Summary of Sequence Search
    1::180
    1::119     1e-10  38%  120 aa  PF00903 Glyoxalase "Glyoxalase/Bleomycin resistance
   76::119     5e-04  39%  142 aa  PF12386 Peptidase_C71 "Pseudomurein endo-isopeptidase Pei"
    1::180

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxQIHHVAYRCKDAKQTVEFYGRVMGMDLIGAIAEDKVPSTKAPDPYMHIFLDAGAGNILAFFELPNS
PF00903         ----RLHHVTLRVRDLEKALRFYTEVLGLRL--------VKRTDCETGGLRLFLRAGGGVILTLNEGPEG
PF12386         ----QIEHVRVRCNDGKWYGHYRLRVKGSELTSGTSWDYVSATKTGRP----------------------


                         .         .         *         .         .         .         .:140
query           PPMGRDPNTPDWTQHIAFQVENIDALLSAKQRAEANGLDVVGPTDHTIFKSIYFWDPSGHRLExxxxxxx
PF00903         ALAG-------WGHHVAFIAFSVDDLDAAVERLKAAGVEVLGEPDRHYFGSRYFFDPDGNLIE-------
PF12386         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00903         ----------------------------------------
PF12386         ----------------------------------------