[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for rpal2:ABE38755.1

[Show Plain Result]


## Summary of Sequence Search
    1::253
    1::123     1e-11  33%  123 aa  PF00005 ABC_tran "ABC transporter"
    1::253

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxTTLFNLITGIYTPCDGEIRLGGELVSGL
PF00005         ------------------------------------------STLLRLLAGLLKPTSGKILLDGVI----


                         .         .         *         .         .         .         .:140
query           APHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVLREHAAELMVYVG
PF00005         SPLELRKLRIGYVFQDPALFPHLTVRENIAFG---------LKNDEKLKEIKKKEA--KEEILEALERVG


                         +         .         .         .         .         *         .:210
query           LEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00005         LLKFLYRYPHELSGGQRQRVAIARALIKEPKVLLLDEPTS------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00005         -------------------------------------------