[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for rpal2:ABE38782.1

[Show Plain Result]


## Summary of Sequence Search
    1::258
   72::169     4e-22  58%  170 aa  PF00378 ECH "Enoyl-CoA hydratase/isomerase family"
    1::258

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00378         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxITRNWETIKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPG
PF00378         -------------LQRLFRRIETLPKPVIAAVNGAALGGGLELALACDIRIAAEDAKFGLPEVKLGLFPG


                         +         .         .         .         .         *         .:210
query           AGGTQRLPRAIGKAKAMDMCLSARPLDAEEADRYGLVSRVVxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00378         AGGTQRLPRLVGPARARELLLTGRRISAEEALALGLVDEVV-----------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00378         ------------------------------------------------