[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for rpal2:ABE38828.1

[Show Plain Result]


## Summary of Sequence Search
    1::372
    5::304     4e-38  38%  323 aa  PF01717 Meth_synt_2 "Cobalamin-independent synthase, Catalytic
    1::372

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxVGSLLRPQSIKDARARLEKGEISAADLRRIEDMEIEKIVHKQSAIGLKLATDGEFRRS
PF01717         ------------IGSFPRPKELRQARAAFKKGEISAEELEAAEDEAIAEVVKKQEELGLDVLTDGEFRRN


                         .         .         *         .         .         .         .:140
query           WWHFDFLSHLTGCELYHPDTGIQFAGVQTRNDSIRVIGKLDFPDDHPMLEHFRFLKRHADIAHVTAKMTI
PF01717         DMVEYFGERLDGFA-FTKNGWVQSYGSRCVKPPI-IVGDVSRP--NPMVEEFKYAQSLTD-KPVKGMLTG


                         +         .         .         .         .         *         .:210
query           PSPAVLHFRGGRKAISSEVYPDLDGFFEDLARTYRKAVKAFYDAGCRYLQFDDTVWAYLCSQDELQKARE
PF01717         P-VTILNWSFVR------YYPDREELAADIALAYRDEVKDLEAAGCRIIQIDEPAL-----REGLPLRRK


                         .         .         .         +         .         .         .:280
query           RGDNPDNLQQIYSRVINYAIAERPSDMVITTHVCRGNFRSTWISSGGYEPVAETLLAGINYDGYFLEYDS
PF01717         DWDAYLDWAVAAFR-LNAAVV--GDDTQIHTHMCYGNFNDIW-----------PLIAALDADVISLEYSR


                         .         *         .         .         .         .         +:350
query           ERAGGFEPLRFLPKGNKVVVVGVITSKFGELEKKDDIKRRLDEAAKFAPLAQLALSPQCGFASxxxxxxx
PF01717         SRAGDLEPLREVPYG-KEVGLGVVDIKSPRVESPEEIAARIEEAAKYVPLERLWVSPDCGFAT-------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxx
PF01717         ----------------------