[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for rpal2:ABE39200.1

[Show Plain Result]


## Summary of Sequence Search
    1::95
    4::70      1e-04  37%   80 aa  PF01541 GIY-YIG "GIY-YIG catalytic domain"
    1::95

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxVYILASRYRGTLYVGVTNDLPRRIAEHKAGAADGFTKKYNIKILVHVEEYSSILEARTREHVLx
PF01541         ------VYIIYDKDGGVLYIGKANNLRRRLRQHLSGEDGKKTKRSNFELLI-VEFFPTKSEALDLENLL-


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxx
PF01541         -------------------------