[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for rpal2:ABE39205.1

[Show Plain Result]


## Summary of Sequence Search
    1::431
    1::270     2e-32  40%  271 aa  PF05065 Phage_capsid "Phage capsid family "
   95::153     2e-04  33%  291 aa  PF03396 Pox_RNA_pol_35 "Poxvirus DNA-directed RNA polymerase, 35 kD
    1::431

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxFDHAPETKAGIAGDDAQQVYDALMRTFEDYKAENDSRLQAIEKRGGDVIAEDK
PF05065         ----------------------------------------------------------------------
PF03396         -----------------FDYYIIDKDGIKVDKPKELKETLLHTFQEYRLKNEQTIELIAFSSGTVINEDL


                         .         .         *         .         .         .         .:140
query           VARIxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF05065         ----------------------------------------------------------------------
PF03396         VSRL------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxGYLVPEELERSIAARLSAISPIRGLASVRQISGSVYKKPFMTAGPATGWVGEAAARPQTSSPTLDAL
PF05065         ---GKLVPEEIVTEIIELLREESPLLQLATVEPTTGGGSLTILVTGGPAAGWVGELGD-PKTDLPTFGEI
PF03396         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           SFPAMELYAMPXXXXXXXXXXXVNLDDWLTGEIDTVFAEQEGAAFVSGDGINKPKGFLAAPTVANAAWSW
PF05065         TLTVKKLAAFVPISNELLDDSPVDLEAYVRERLAEAIARAEEAAILNGTGTGQPKGLLK-----------
PF03396         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           GNLGFVATGAAGAFPASNPSDVLIDLMFALKPGYRQNASFVMNRRTQAAIRKFKDNNGVYLWQPPATASG
PF05065         -DKGAVAVTTDGAKVAGTLTDDLVDLVAALDAAYRANAVFVMNPSTAAALRKLKDANGRYLLQPSLTAGG
PF03396         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           RASLIGFPLADAEDMPDIAANSLAIAFGDFRRGYLIVDRQGVRVLRDPYSAKPYVLFYTTKRVGGGVQDF
PF05065         -PTLLGLPVVVSDAM---AAPAGKIIFGDF-SAYILGDRGGITIERDTLFEKDMVAFRAEERLDGAVVDP
PF03396         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           DAIKLLxxxxx
PF05065         KAVKLL-----
PF03396         -----------