[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for rpal2:ABE39379.1

[Show Plain Result]


## Summary of Sequence Search
    1::1070
    4::1012    e-155  36% 1014 aa  PF00873 ACR_tran "AcrB/AcrD/AcrF family"
  150::274     1e-04  28%  284 aa  PF03176 MMPL "MMPL family"
   73::146     0.001  38%  172 aa  PF03808 Glyco_tran_WecB "Glycosyl transferase WecB/TagA/CpsF
    1::1070

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxFSVRQRWLVMIGVLMMAAFGAWNFTRLPIDAVPDITNVQVQINTNAPGYSPLEVEQRITFPIE
PF00873         -------FFIRRPVLALLLALLLLLAGLLALFKLPVEEFPDITPPQVTVSTSYPGASPEEVEELVTKPLE
PF03176         ----------------------------------------------------------------------
PF03808         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           TAMGGLPNLVNTRSLSRYGLSQVTVVFKDGTDIYFARQLVNERVQRVKDILPVGIETAMGPVSTGLGEIY
PF00873         RALNGIPGVKYIRSTSSEGLSSITVEFKDGTDIDEALVDVQNKLNAARSRLPEGVEEGVGPDSTSDVPIL
PF03176         ----------------------------------------------------------------------
PF03808         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           MYTVEAKEGAKNAEGKPYTPSDLRTAQDWIIKPQLRNVAGVNEVNTIGGFEKQFHVLPDPARLMAYRLSF
PF00873         VLAL-------TSDG--YDLAELRDYADWNLRDELERVPGVGEVDIFGGREREIRVELDPDKLAAYGLTL
PF03176         ----------------------------------------------------------------------
PF03808         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           RDVMTSLASNNANVGAGYIEKNGEQYLVRTPGQVANVEDIRQIVIGSRNGVPVRIMDVAEVKEGTDLRTG
PF00873         ADVANALRAQNVNVPAGSIEGGGQEYLVRANGRLKSAEDLENIVVKNRDGRPVRLGDVATVEDGPEDRRG
PF03176         ----------------------------------------------------------------------
PF03808         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           AATVSGKEVVLGTAMLLIGENGRTVAQRVAAKLEQIQKSLPEGISLRAIYDRTHLIDATIATVEKNLIEG
PF00873         IARFNGKPAVGLAVAKRPGANALEVADAVKAKLEELQASLPAGVEITVTYDQSEFIRASINEVVKTLLEA
PF03176         ----------------------------------------------------------------------
PF03808         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           XXXXXXXXXXXXGNIKAAFATALVIPLSMLFTITGMFENKVSANLMSLGXXXXXXXXXXXXXXXENCLRL
PF00873         ILLVVLVLFLFLGNWRATLIVALAIPLSLLGTFAVMYLFGFSLNLLSLFALILAIGILVDDAIVENIHR-
PF03176         ----------------------------------------------------------------------
PF03808         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           LAHEQQRRGRLLTREERFETIIAGAREVIKPSLFGTLIIAVVYLPVLTLTGVEGKMFTPMAXXXXXXXXX
PF00873         --HLEEGLSPL-------EAAIKAAKEVGGPVIASTLTTIAVFLPLAFLSGITGELFRPFAITVAIALLA
PF03176         ----------------------------------------------------------------------
PF03808         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           XXXXXXXFVPAAVALMVTGKVSEKENWFMRLAHRTYXXXXXXXXXXXXXXXXXXXXXXXXSGYAATRMGG
PF00873         SLLVALTLTPALAALLLKPKKKEEHGWFNRLFDRLYRRLLRWALRHRKLVLLVALLLLVLSLLLFPRVPT
PF03176         ----------------------------------------------------------------------
PF03808         ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           EFIPSLDEGDVAIQAMRIPGTSLTQSLEMQMALEKRLLAIPEVKEAFARTGTAEVATDPMPPSISDGYVM
PF00873         EFFPEEDEGEFQVMVELPPGTSLEETDAVLQQVEKILKEVPEVESVFSYVGRA-FAGDPAGPNSGEIFVN
PF03176         ----------------------------------------------------------------------
PF03808         ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           LKPRDQWPDPKKPKLEVMKEIETASEEVAGNLYELSQPIQLRFNELISGVRSDVGVKIFGXXXXXXXXXX
PF00873         LKP---WDERDRSSDEIIARLREALAKIPGARVFVFQPPDIRGLGLGPGVRAPIQIKLYGPDLEELRAAA
PF03176         ----------------------------------------------------------------------
PF03808         ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           XXXXXXXXTIKGAADVKTEQVAGLPVLTVKLDRQALARFGINVADVQSLVEIAVGGKSAGLVFEGDRRFD
PF00873         EQLEAALRQVPGLVDVRDDLQEGGPELRIDIDREKAARLGVSVADVAQTLRTALGGRYVGTFREGGRRYP
PF03176         ----------------------------------------------------------------------
PF03808         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           LVVRLPDHLRTDVEAIKRLPIPLPPADGQAKATPAVFGNSPLAQMRYAPLAELAEISVSPGPNQISREDG
PF00873         VVVRLPEEYRSSPEDLENLPV-----------------RTPSGQM--VPLSAVATIEETTGPPSINRENG
PF03176         ----------------------------------------------------------------------
PF03808         -----------------------------------------------------------PGLRIVGTHDG


                         +         .         .         .         .         *         .:910
query           KRRIVVSANVRGRDLGSFVGEAQQLVAGKVKLPAGYWIGWGGQFEQLVSATERLTIVVPXXXXXXXXXXX
PF00873         RRVVTVSADVAGDSLGEALAAIEELAA-ELKLPPGYSIEWGGEAEEQQEAFASLGLAFPLALLLIYLLLA
PF03176         ----------------------------------------------------------------------
PF03808         EEAIVERINASGPDL-VFVGQEKWIARNRDRLPARVWIGVGGSFDFLAGTVKR-----------------


                         .         .         .         +         .         .         .:980
query           XXXXXXXDALLVFSGVPLALTGGIFALLLRGIPLSISAGIGFIALSGVAVLNGLVIITFIERLRGDGRKI
PF00873         AQFESFSQPLIILLTVPLALIGALLGLLLTGLPFSVYSMIGFIALAGIVVKNAILLVDFANQLRREGMSL
PF03176         --------SLLAALGLVLVLAGGL------GIGLSFTPVLAFVLLLGLGVDYAIFLVSRYREELAAGGDR
PF03808         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:1050
query           VDAVREGALTRLRPVLMTALVASLGFVPMALATGAGAEVQRPLATVVIGGIVSSTILTLLVLPALYILFR
PF00873         REAIIEAARLRLRPILMTALATILGLLPLALGTGAGAEIRQPLAIAVIGGLLFSTLLTLFVVPVLYVL--
PF03176         EEAVRRALRTTGRAITFAALTVAIGFAALLFSP---IPFLRQLGLALAIGVLLAALVVLTLLPALLVLLG
PF03808         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:1120
query           Rxxxxxxxxxxxxxxxxxxx
PF00873         --------------------
PF03176         R-------------------
PF03808         --------------------