[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for rpal2:ABE39396.1

[Show Plain Result]


## Summary of Sequence Search
    1::313
   17::201     4e-15  32%  201 aa  PF01068 DNA_ligase_A_M "ATP dependent DNA ligase domain"
    1::313

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxGAGWIHEIKLDGYRGQAHVGPQGTRIYTRGGHD
PF01068         -------------------------------------GGDFLAEEKYDGERAQIHKDGGEVRLFSRNGED


                         .         .         *         .         .         .         .:140
query           WSKMFAPLVAALSDAAXXXXXXXXXXXXXXXXRTDFGXXXXXXXXXXXXXMLFYAFDLLHLDGYDLGPVP
PF01068         ITAKFPDLVEALRELFLPDVPSFILDGELVAWDPETGKILPFQALQTRLNVCLFAFDLLYLNGEDLLDLP


                         +         .         .         .         .         *         .:210
query           LTERKRLLKGLFDRGLEPPVVYSDSMDDGEAMFDGAGRLGWEGIVSKRADAPYRSGDRSLDWQKIKxxxx
PF01068         LRERRALLEELV-KPIPGRIELSESLEELEAFLEEAVAAGLEGLMLKRPDSPYEPGKRSGDWLKLK----


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01068         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01068         ---------------------------------