[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for rpal2:ABE39446.1

[Show Plain Result]


## Summary of Sequence Search
    1::281
   14::280     9e-35  44%  281 aa  PF00248 Aldo_ket_red "Aldo/keto reductase family"
    1::281

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxDRTAAIAALRRGLDLGMTHIDTAEMYGDAEPLVAEAIDGRRD
PF00248         ----------------------------DEEEAIELLDAALEAGINFIDTAEIYGDSEELLGEALKEGRE


                         .         .         *         .         .         .         .:140
query           EVFLVSKVLPSNASRSGAIAACERSLKRLKTDRLDCYLLHWRGKVRLADTVAAFEELVAAGKIRSWGVSN
PF00248         DVFIATKVWPPDLSPEHIRASVEASLKRLGTDYIDLYLLHWPDPPRIEETLEALEELVKEGKIRYIGVSN


                         +         .         .         .         .         *         .:210
query           FDAGDLWELLKVAGPGRIACNQVLYHLRERAIEHAVVPWCEAHGVAVTAYSPFGHDEFPEPRSAEGRLLQ
PF00248         FTAEQLEELLAHAKIPPVVV-QVEYNLLRRLEERELLPYCRENGIGVVAYSPLGGKYLPEADPAPGEELK


                         .         .         .         +         .         .         .:280
query           AIAGAHGATPRQVALAFLTRRPSLFAIPKXXXXXXXXXXXXXXSLRLSDEEIAAIDQAxxxxxxxxxxxx
PF00248         EIAEKHGVTPAQVALAWVLSRPGVTSIPGASTPEQLEENLAALDFELTDEELAEIDAA------------


                         .         *         .         .         .         .         +:350
query           x
PF00248         -