[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for rpal2:ABE39477.1

[Show Plain Result]


## Summary of Sequence Search
    1::152
    1::79      3e-04  38%   79 aa  PF03061 4HBT "Thioesterase superfamily"
    1::152

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxAGNVQGGFLAAMLDDTMGP
PF03061         ---------------------------------------------------AGHVHGGVYATLLDEARGA


                         .         .         *         .         .         .         .:140
query           ALVATLGAGEFAPTVSLNVQFHRPARVGALKGIGRVLLRGKEVCQLSGELLQDDRVVAxxxxxxxxxxxx
PF03061         AAARLGGAGRGVVTVELNIDYLRPVRVGRLEVRARVVRLGRRSATVEVEVRDEDGAAA------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxx
PF03061         ------------