[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for rpal2:ABE39592.1

[Show Plain Result]


## Summary of Sequence Search
    1::263
    9::105     2e-08  38%  127 aa  PF01614 IclR "Bacterial transcriptional regulator"
    2::52      9e-05  45%   52 aa  PF09339 HTH_IclR "IclR helix-turn-helix domain"
    1::263

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxLARYIDVLEVIAAFSGAITLADVSSILDLPKTTAHRLLKGLVRAGLAVEGDAxxxxxxxx
PF01614         ----------------------------------------------------------------------
PF09339         ----------LERALAILEALAEAPGPLTLSELAERTGLPKSTVHRLLATLEELGL-VERDA--------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxGIEMPVNA
PF01614         --------------------------------------------------------------GSRLPLHA
PF09339         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           AATGKAIMAFQSKVLIAEALSHELPKPTINSHTSRKWIEQEFAKVRTNGYATCIGEIDEGLAAIAVPVRL
PF01614         TASGKALLAFEREALLARL---ELAALTPRTITDPAELRAELAEIRARGYAVDDGELEPGVAAVAVPVFD
PF09339         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           PNGAVLHSVGMTGPLERIxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01614         ASGRVVAALSVSGPASRL-----------------------------------
PF09339         -----------------------------------------------------