[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for rpal2:ABE39673.1

[Show Plain Result]


## Summary of Sequence Search
    1::441
    1::173     8e-24  43%  175 aa  PF01520 Amidase_3 "N-acetylmuramoyl-L-alanine amidase"
   23::92      3e-09  44%  103 aa  PF11741 AMIN "Localisation of periplasmic protein complexes"
    1::441

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxTRFV
PF01520         ----------------------------------------------------------------------
PF11741         ------------------------------------------------------------------TRVV


                         .         .         *         .         .         .         .:140
query           IDLDRTVPMRAFALADPYRVVIDLPQVNFRLPAASGGTGRGLIKAYRYGLVMPGGSRVVLELSGPAxxxx
PF01520         ----------------------------------------------------------------------
PF11741         LELSGPVKYKVFTLSNPDRLVIDLPGARLGLPLKDLSSGDGLIKSVRVGQFDPGTVRVVLDLEKAA----


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01520         ----------------------------------------------------------------------
PF11741         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           IVLDPGHGGIDNGTQSQSGVSEKALVLEFALALRDQMEKGGKYRVVLTRTDDTFIPLNDRVKIARAHSAA
PF01520         IVIDPGHGGKDPGAIGPNGVKEKDVTLEVAKRLAKLLEAAGA-KVVLTRDSDEFVSLRERAEIANKLKAD
PF11741         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           LFVSIHADALPRGEGDAQGATIYTLSDKASDAEAQRLADAENKADAIGGVNLTEEPTEVADILIDLAQRE
PF01520         LFISIHANAAPNSA--ARG----------------------------------------AEVFYDLSQNE
PF11741         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           TKTFSNRFAQTLMREMKSATRLHKQPLKSAGFRVLKAPDVPSVLLELGYVSNKGDLKQLVSEQWRTKTVG
PF01520         SSAESKRLAKAILKELVKAGGLPNRGVKEANLYVLRNTDMPSVLVELGFISNPEDEALLNSPKYQQKIAK
PF11741         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           AVALAIxxxxxxxxxxxxxxx
PF01520         AIAKGI---------------
PF11741         ---------------------