[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for rpal2:ABE39735.1

[Show Plain Result]


## Summary of Sequence Search
    1::351
    9::333     8e-07  35%  337 aa  PF00152 tRNA-synt_2 "tRNA synthetases class II (D, K and N) "
    1::351

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxRYLDRKPFLRARSAVTXXXXXXXXXXXXXXVETAILQLSPGNETHLHAPRTEFKGP
PF00152         --------------RYLDLRAIFRLRSKVIQAIRRFLDERGFLEVETPILTKSPEGAARPFLVPGHFFAK


                         .         .         *         .         .         .         .:140
query           DGELRTRFLRTSPEFACKKLLAAGEERIFEFARVFRDRERGRLHLPEFTMLEWYRAGEGYQTVxxxxxxx
PF00152         DA-----YLPQSPQLYKQLLMVAGFDRVYEIGPCFRNEDRTDRHLPEFTMLELEMAFADYEDV-------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00152         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxDDPRVAERFEVYACGVELANGFGELTDA
PF00152         ------------------------------------------DDPRLTESYDLLLNGGEIGGGSQRIHDP


                         .         *         .         .         .         .         +:350
query           AEQRLRFTASMDEKERRYGERYPLDEDFLAAVGRMPEASGVALGFDRLVMLAAGAMRIDQVVWTPxxxxx
PF00152         EEQLERFEQGIDPEEAMEKFGWYLDALEYGA----PPHGGFGLGLDRLVMLLTGLDNIRDVIAFP-----


                         .         .         .         .         *         .         .:420
query           x
PF00152         -