[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for rpal2:ABE39967.1

[Show Plain Result]


## Summary of Sequence Search
    1::139
   46::83      7e-04  47%  272 aa  PF10521 DUF2454 "Protein of unknown function (DUF2454)"
    1::139

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF10521         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxKVYPKYRSLKDPSLTWAGRGKQPLWLIDELKSGKSIDDFLIRAKPxxxxxxxx
PF10521         ----------------KLRPLFSKTKNPAITAAGRGLHP-------KLGPSFDDSIIERKP--------