[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for rpal2:ABE40040.1

[Show Plain Result]


## Summary of Sequence Search
    1::344
    4::292     4e-51  41%  298 aa  PF00676 E1_dh "Dehydrogenase E1 component"
   15::138     3e-04  34%  139 aa  PF02775 TPP_enzyme_C "Thiamine pyrophosphate enzyme, C-terminal TPP
    1::344

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLIRRFEEKAGQLYGMGAIGGFCHLYIGQE
PF00676         -----------------------------------------LIRRFEDFLATKYQRQKRFGFEHGESGQE
PF02775         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           AVVVGMQMALREGDQVITGYRDHGHMLACEMDAKGVMAELTXXXXXXXXXXXXXMHMFSMEKHFYGGHGI
PF00676         ALQVGIAAALRPGDVVIGMYRGHLNVLANGLGPKEIFAEF-FGKATDVKGKGGSMHGFSSDKNFLGANGP
PF02775         -----------------------------------------------------------------GGLGS


                         +         .         .         .         .         *         .:210
query           VGAQVSLGTGIAFANRYRDNGSVCLAYFGDGASNQGQVYESFNMAELWKLPVVYVIENNRYAMGTSVTRS
PF00676         SGLQIPVAAGAARARKLKGKDVVVVAVHGDGAAGQGVVYEALNLAGLWGLPVIFVVENNQYGISTPPERQ
PF02775         MGYGLPAALGAALANPDRR----VVAVIGDGAF--GMSLQELNTAVRYGLPIIIVVLNNEYGMGGQQTPF


                         .         .         .         +         .         .         .:280
query           SAQTDFSKRGVSFNIPGEQVDGMDVRAVKAAGDKAVAHCRAGNGPYILEMQTYRYRGHSMSDPAKYRTRE
PF00676         RSSPYITDRAKGYGIPGFHVDGDDPEAVYAATKLAVEYRRKGKGPVLIELVTYRRGGHSESDDPSFYRPE
PF02775         GAKPDFAKLAEAYGAKGARV------TTPEELEKALKEALATDGPVLIE---------------------


                         .         *         .         .         .         .         +:350
query           EVDKIRNDQDPIEQVRQRLLGSDMTEDDLKKIDAEVRKIVNEAADFAQxxxxxxxxxxxxxxxx
PF00676         EYEEIRKHRDPIKRYAKKLIEEGLTEEELEAIEKEVRAEVEEAVEFAE----------------
PF02775         ----------------------------------------------------------------