[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for rpal2:ABE37468.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1a32A.bssp"

## Summary of PDB Search
:89
    2e-22  54%  1a32A  [a.16.1.2] RIBOSOMAL PROTEIN S15
:89

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxITAERKAEVIQGNANKAGDTGSPEVQVAILSERIVNLTAHFKTHTKDNHSRRGLLKLVSTRRSLLDYV
1a32A           --LTQERKREIIEQFKVHENDTGSPEVQIAILTEQINNLNEHLRVHKKDHHSRRGLLKMVGKRRRLLAYL


                         .         .         *         .         .         .         .:140
query           KKKDEARYKALLEKHNIxx
1a32A           RNKDVARYREIVEKLGL--