[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for rpal2:ABE37597.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1v9kA.bssp"
#ERROR : Can't open dsspfile "1przA.bssp"
#ERROR : Can't open dsspfile "1kskA4.bssp"
#ERROR : Can't open dsspfile "2apoA2.bssp"
#ERROR : Can't open dsspfile "1r3eA2.bssp"
#ERROR : Can't open dsspfile "1k8wA5.bssp"
#ERROR : Can't open dsspfile "1ze2B2.bssp"
#ERROR : Can't open dsspfile "1s72A1.bssp"
#ERROR : Can't open dsspfile "1fjgD.bssp"
#ERROR : Can't open dsspfile "1h3eA2.bssp"
#ERROR : Can't open dsspfile "1vioA2.bssp"
#ERROR : Can't open dsspfile "1jh3A.bssp"
#ERROR : Can't open dsspfile "1p9kA.bssp"
#ERROR : Can't open dsspfile "1dm9A.bssp"

## Summary of PDB Search
:426
    1e-50  34%  1v9kA  [d.265.1.3] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE C
    1e-45  45%  1przA  [d.265.1.3] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE D
    2e-29  22%  1kskA4 [d.265.1.3] RIBOSOMAL SMALL SUBUNIT PSEUDOURIDINE SYNTHASE A
    4e-28  17%  2apoA2 [d.265.1.2] PROBABLE TRNA PSEUDOURIDINE SYNTHASE B A:17 --
    8e-25  12%  1r3eA2 [d.265.1.2] TRNA PSEUDOURIDINE SYNTHASE B A:10 -- 237
    1e-23  15%  1k8wA5 [d.265.1.2] TRNA PSEUDOURIDINE SYNTHASE B A:9 -- 250
    5e-22  16%  1ze2B2 [d.265.1.2] TRNA PSEUDOURIDINE SYNTHASE B B:1 -- 228
    2e-21  12%  1s72A1 [b.34.5.3] 50S RIBOSOMAL PROTEIN L2P A:91 -- 237
    5e-11  17%  1fjgD  [d.66.1.2] 30S RIBOSOMAL PROTEIN S4
    2e-09  16%  1h3eA2 [d.66.1.4] TYROSYL-TRNA SYNTHETASE A:352 -- 432
    1e-08  27%  1vioA2 [d.66.1.5] RIBOSOMAL SMALL SUBUNIT PSEUDOURIDINE SYNTHASE A
    2e-08  15%  1jh3A  [d.66.1.4] TYROSYL-TRNA SYNTHETASE
    4e-08  20%  1p9kA  [d.66.1.6] ORF, HYPOTHETICAL PROTEIN
    4e-07  13%  1dm9A  [d.66.1.3] HYPOTHETICAL 15.5 KD PROTEIN IN MRCA-PCKA
:426

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1v9kA           ----------------------------------------------------------------------
1przA           ----------------------------------------------------------------------
1kskA4          ----------------------------------------------------------------------
2apoA2          ----------------------------------------------------------------------
1r3eA2          ----------------------------------------------------------------------
1k8wA5          ----------------------------------------------------------------------
1ze2B2          ----------------------------------------------------------------------
1s72A1          ----------------------------------------------------------------------
1fjgD           ----------------------------------------------------------------------
1h3eA2          ----------------------------------------------------------------------
1vioA2          ----------------------------------------------------------------------
1jh3A           ----------------------------------------------------------------------
1p9kA           ----------------------------------------------------------------------
1dm9A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxVFLEGSIVNDSSGHLLEVVVAGDEGSPRLDRVLATRCPALSRSRLKALILDGRVA
1v9kA           ----------------------------------------------------------------------
1przA           ----------------------------------------------------------------------
1kskA4          ----------------------------------------------------------------------
2apoA2          ----------------------------------------------------------------------
1r3eA2          ----------------------------------------------------------------------
1k8wA5          ----------------------------------------------------------------------
1ze2B2          ----------------------------------------------------------------------
1s72A1          ----------------------------------------------------------------------
1fjgD           ---------------LFEEASKKKGVTGSVFL-----GLLESRLDNVVYRLGFAVSRRQARQLVRHGHIT
1h3eA2          ----------------------------------SELKEGRIWVARLFTLAGLTPSNAEARRLIQNRGLR
1vioA2          ----------------------------------------SLRLDKFIA-ENVGLTRSQATKAIRQSAVK
1jh3A           -------------------------------------EGGDVPLVELLVSAGISPSKRQAREDIQNGAIY
1p9kA           -------------------GSMIHRMSNMATFSLG--KHPHVELCDLLKLEGWSESGAQAKIAIAEGQVK
1dm9A           ------------------------------------------RLDKWLWAARFYKTRALAREMIEGGKVH


                         +         .         .         .         .         *         .:210
query           IRGAPVRDPAYHAASGETITIDXXXXXXXXXXXXXXXLXXXXXXXXXXXXXKPRGLVVHPAAGHETGTLV
1v9kA           ---------------------------------------------------KPSGTAVHGGSGLSFGVIE
1przA           ---------------------------------------------------KPRDLVVHPGAGNPDGTVL
1kskA4          ---------------------------------------------------KPQGYVCSTDDPDH-PTVL
2apoA2          ---------------------------------------------------KPRGPTSHEVSTW------
1r3eA2          ---------------------------------------------------KPKGPTSHDVVDE------
1k8wA5          ---------------------------------------------------KPQGMSSNDALQK------
1ze2B2          ---------------------------------------------------KPKGPTSHDVVDE------
1s72A1          ----------------------------------------------------------------------
1fjgD           VNGRRVDLPSYRVRPGDEIAVAEKSRNLELIRQNLEAKGRKVGPWLSLDVEGMKGKFLRLPDREDLALPV
1h3eA2          LDGEVLTDPMLQVDLSRPRILQ------------------------------------------------
1vioA2          INGEIVKSGSVQISQEDEIYFE------------------------------------------------
1jh3A           VNGERLQDVGAILTAEHRLEGR------------------------------------------------
1p9kA           VDGAVETRKRCKIVAGQTVSFA------------------------------------------------
1dm9A           YNGQRSKPS-KIVELNATLTLRQGNDERTVIVKAITEQRRPASEAALLYEETAESVEKR-----------


                         .         .         .         +         .         .         .:280
query           NALIAHCGESLSGIGGVRRPGIVHRLDKDTTGLMVAAKNDRAHQSLSAQFADHGRTGELRRGYYAFVWGA
1v9kA           GLRALR--------PEARFLELVHRLDRDTSGVLLVAKKRSALRSLHEQLREK----GXQKDYLALVRGQ
1przA           NALLHYYPPI----ADVPRAGIVHRLDKDTTGLXVVAKTVPAQTRLVESLQRR----EITREYEAVAIG-
1kskA4          YFLDEPVAW---------KLHAAGRLDIDTTGLVLXTDDGQWSHRI--TSPRH----HCEKTYLVTLES-
2apoA2          ----------VKKILNLDKAGHGGTLDPKVTGVLPVALERATKTIPMWH--------IPPKEYVCLMHLH
1r3eA2          ----------VRKKLKTRKVGHGGTLDPFACGVLIIGVNQGTRILEFYK--------DLKKVYWVKMRLG
1k8wA5          ----------VKRIYNANRAGHTGALDPLATGMLPICLGEATKFSQYLLDSD--------KRYRVIARLG
1ze2B2          ----------VRKKLKTRKVGHGGTLDPFACGVLIIGVNQGTRILEFYK--------DLKKVYGEYDQVP
1s72A1          -------------LAEIPEGVPVCNVESSPGDGGKFARASGVNAQLLTHDRNV----AVVKLPSGEMKRL
1fjgD           QEN-------------------------------------------------------------------
1h3eA2          ----------------------------------------------------------------------
1vioA2          ----------------------------------------------------------------------
1jh3A           ----------------------------------------------------------------------
1p9kA           ----------------------------------------------------------------------
1dm9A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           PNRIRGTIDAPIDRHPHAREKMAVRDGGREAITHWEVLETFTGRSGGEIVSLIACQLETGRTHQIRVHLA
1v9kA           WQSHVKSVQAPLLKNILQSGEVRVSQEGKPSETRFKVEERYAFAT------LVRCSPVTGRTHQIRVHTQ
1przA           HXTAGGTVDEPISRHPTKRTHXAVHPXGKPAVTHYRIXEHFRV------HTRLRLRLETGRTHQIRVHXA
1kskA4          ----------PVADDTAEQFAKGVQLHNEKDLTKPAVLEVITPT-------QVRLTISEGRYHQVKRXFA
2apoA2          RDASEEDILRVFKEFTGRIYQR-----RIRKIHELELLDKDG--------KDVLFRVKCQSGTYIRKLCE
1r3eA2          LITETFDITGKGERLYKLAREGKIINLPPKRVKIFKIWDVNIEG------RDVSFRVEVSPGTYIRSLCM
1k8wA5          QRTDTSDADGQIVEERPVTFSAEQ--------------------------LAAALDTFRGDIEQIPSMYS
1ze2B2          PAYSAKKYKGERLYKLAREGKIINLPPKR--------------------VKIFKIRVEVSPGTYIRVRES
1s72A1          DPQCRGRTDKPFVKAGNKHHKMKARGTKWPNVRGV--------------AMNAVDHPFGGGGRQHP----
1fjgD           ----------------------------------------------------------------------
1h3eA2          ----------------------------------------------------------------------
1vioA2          ----------------------------------------------------------------------
1jh3A           ----------------------------------------------------------------------
1p9kA           ----------------------------------------------------------------------
1dm9A           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           HIGHPLLGDDVYGPHFKTKASQLRPDARAALTDLGRQALHAYLLVLEHPSTGEVVAWESGLPADLKRLKA
1v9kA           YAGHPIAFDDRYGDR------EFDRQLTEAGTGLNRLFLHAAALKFTHPGTGEVXRIEAPXDEGLKRC--
1przA           HITHPLVGDPVYG-GRPRPPKGASEAFISTLRKFDRQALHATXLRLYHPISGIEXEWHAPIPQDXVEL--
1kskA4          AVGNHVVELHRERIGGITLDADLAPGEYRPLTE-------------------------------------
2apoA2          DIGEALGTSAHMQELRRTK---------------SGCFEEKDAVYLQDLLDAYVFWKEDGDEEELRRV--
1r3eA2          DIGYKLGCGATAVELVRESVGPHTIEESLNVFEAAPEEIENRIIPLEKC---------------------
1k8wA5          ALKYQGKKLYEYARQGIE-------------VPREARPITVYELLFIRHEGNELELEHCSKGTYIRTIID
1ze2B2          VGPHTIEESLNVFEA---------------APEEIENRIIPLEKCLE-----------------------
1s72A1          --GKPKSISRNAPPGRKVG---------------DIASKRTG----------------------------
1fjgD           ----------------------------------------------------------------------
1h3eA2          ----------------------------------------------------------------------
1vioA2          ----------------------------------------------------------------------
1jh3A           ----------------------------------------------------------------------
1p9kA           ----------------------------------------------------------------------
1dm9A           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           ALxxxx
1v9kA           ------
1przA           ------
1kskA4          ------
2apoA2          ------
1r3eA2          ------
1k8wA5          DL----
1ze2B2          ------
1s72A1          ------
1fjgD           ------
1h3eA2          ------
1vioA2          ------
1jh3A           ------
1p9kA           ------
1dm9A           ------