[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for rpal2:ABE37710.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1zceA1.bssp"
#ERROR : Can't open dsspfile "1wmmA1.bssp"

## Summary of PDB Search
:137
    5e-41  47%  1zceA1 [b.122.1.8] HYPOTHETICAL PROTEIN ATU2648 A:2 -- 147
    2e-16  17%  1wmmA1 [b.122.1.8] HYPOTHETICAL UPF0310 PROTEIN PH1033 A:1 -- 145
:137

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MAYWLVKSEPSVWSWDQQVAKGAKGEAWTGVRNHSAKLHMIAMKKGDRAFFYHSNXXXXXXXXXXXXXXX
1zceA1          --YWLYKSEPFKWSWEXQKAKGETGEEWTGVRNYQARNNXRAXKIGDKGFFYHSNEGLDVVGIVEVCALS
1wmmA1          MTYWICITNRENWEVIK--------RHNVWGVPKKHKNTLSRVKPGDKLVIYVRQEKDKEGNLLEPKIVG


                         .         .         *         .         .         .         .:140
query           YPDPTDESGKFVCVDLKADKKLKTPVTLVAVKAEPRLAEMALLKYSRLSVQPVTADEWKLICKMGGL
1zceA1          HPDSTAGDLKWDCVDIRAVCDXPQPVSLKDVKANPKLEKXSLVTSXRLSVQPVTEEEYLEVCRXGGL
1wmmA1          IYEYVDFSRIFKPGGKETYPYRVKPIKIGEINFKPLINDLKFIKNKRWSMHELPEEDYKLIEKL---