[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for rpal2:ABE37723.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1nyoA.bssp"
#ERROR : Can't open dsspfile "1o70A1.bssp"
#ERROR : Can't open dsspfile "1o70A2.bssp"

## Summary of PDB Search
:194
    8e-26  45%  1nyoA  [b.118.1.1] IMMUNOGENIC PROTEIN MPT70
    3e-25  24%  1o70A1 [b.118.1.1] FASCICLIN I A:328 -- 467
    1e-21  21%  1o70A2 [b.118.1.1] FASCICLIN I A:468 -- 624
:194

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1nyoA           ----------------------------------------------------------------------
1o70A1          ----------------------------------------------------------------------
1o70A2          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxEGKGPFTVFAPTNAAFGKLPAGTVDTLVKPESKATLTKILTYHVVPGKLAAADLTDG
1nyoA           ----------------GQYTVFAPTNAAFSKLPASTIDEL--KTNSSLLTSILTYHVVAGQTSPANVV--
1o70A1          -------------NSLTEVTILAPSNEAWNS---SNINNVLRDRNK--MRQILNMHIIKDRLNVDKIRQK
1o70A2          -------------NTQRRFTYFVPRDKGWQKTELDYPSAHKKADFSYHSKSILERHLAISDYTMKDLVKF


                         +         .         .         .         .         *         .:210
query           KKLTTVEGATLTVKRSGDQVMLVDAKGGSSTVTIPNVNQSNGVIHVVDTVLMPx
1nyoA           GTRQTLQGASVTVTGQGNSLKV-----GNADVVCGGVSTANATVYMIDSVLMP-
1o70A1          NANLIAQVPTVNNNTGSDTVITVEGGGVNATVIQADVAQTNGYVHIIDHVLGV-
1o70A2          ILPTFRDSLSIRVEEEAGRYV-IIWNYKKINVYRPDVECTNGIIHVIDYPLLE-