[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for rpal2:ABE37731.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1brmA2.bssp"
#ERROR : Can't open dsspfile "2gyyA1.bssp"
#ERROR : Can't open dsspfile "2gyyA2.bssp"
#ERROR : Can't open dsspfile "2hjsA2.bssp"
#ERROR : Can't open dsspfile "1b7gO2.bssp"
#ERROR : Can't open dsspfile "1vknA1.bssp"
#ERROR : Can't open dsspfile "1nvmB1.bssp"
#ERROR : Can't open dsspfile "2hjsA1.bssp"
#ERROR : Can't open dsspfile "1brmA1.bssp"
#ERROR : Can't open dsspfile "1jvsA2.bssp"
#ERROR : Can't open dsspfile "1u1iA1.bssp"
#ERROR : Can't open dsspfile "1xq6A.bssp"

## Summary of PDB Search
:344
    2e-67  31%  1brmA2 [d.81.1.1] ASPARTATE-SEMIALDEHYDE DEHYDROGENASE A:134 -- 354
    5e-37  40%  2gyyA1 [c.2.1.3] ASPARTATE BETA-SEMIALDEHYDE DEHYDROGENASE A:2 --
    3e-36  41%  2gyyA2 [d.81.1.1] ASPARTATE BETA-SEMIALDEHYDE DEHYDROGENASE A:128
    2e-33  29%  2hjsA2 [d.81.1.1] USG-1 PROTEIN HOMOLOG A:130 -- 319
    3e-22  18%  1b7gO2 [d.81.1.1] PROTEIN (GLYCERALDEHYDE 3-PHOSPHATE O:139 -- 300
    8e-20  21%  1vknA1 [c.2.1.3] N-ACETYL-GAMMA-GLUTAMYL-PHOSPHATE REDUCTASE A:1 --
    3e-18  24%  1nvmB1 [c.2.1.3] ACETALDEHYDE DEHYDROGENASE (ACYLATING) B:1 -- 131
    3e-13  36%  2hjsA1 [c.2.1.3] USG-1 PROTEIN HOMOLOG A:3 -- 129 A:320 -- 336
    6e-10  14%  1brmA1 [c.2.1.3] ASPARTATE-SEMIALDEHYDE DEHYDROGENASE A:1 -- 133
    2e-06  21%  1jvsA2 [c.2.1.3] 1-DEOXY-D-XYLULOSE 5-PHOSPHATE REDUCTOISOMERASE
    2e-04  11%  1u1iA1 [c.2.1.3] MYO-INOSITOL-1-PHOSPHATE SYNTHASE A:1 -- 227 A:333
    3e-04  26%  1xq6A  [c.2.1.2] UNKNOWN PROTEIN
:344

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xGYKVAVVGATGNVGREMLAILDERKFPADEVVALASRRSIGVEVSYGDKTLKCKALEHYDFSDVDICLM
1brmA2          ----------------------------------------------------------------------
2gyyA1          -GYTVAVVGATGAVGAQMIKMLEESTLPIDKIRYLASGKSL----KFKDQDITIEETTETAFEGVDIALF
2gyyA2          ----------------------------------------------------------------------
2hjsA2          ----------------------------------------------------------------------
1b7gO2          ----------------------------------------------------------------------
1vknA1          ---RAGIIGATGYTGLELVRLL--KNHPEAKITYLSSRTYAGKKLELENSILSEFDPEKVS-KNCDVLFT
1nvmB1          ---KVAIIGS-GNIGTDLMIKVLRNAKYLEMGAGLARAQRMGVTTTYAGVEGLIKLPEFADI-DFVFDAT
2hjsA1          -PLNVAVVGATGSVGEALVGLLDERDFPLHRLHLLASAESAGQRXGFAESSLRVGDVDSFDFSSVGLAFF
1brmA1          ---NVGFIGWRGMVGSVLMQRMVEERDFDAIRPVFFSTSQLGQAAPSFGGTTGTLQDAFDLEALKALDCQ
1jvsA2          -GKQLTILGSTGSIGCSTLDVVRHNPEHFRVVALVAGKN-------------------------------
1u1iA1          ---KVWLVGAYGIVSTTAMVGARAIERGIAPKIG-------LVSELPHFEGIEKYAPFSFEFGGHEIRLL
1xq6A           ---TVLVTGASGRTGQIVYKKLKEGS---DKFVAKGLVRSGEADVFIGDITDADSINPAFQGIDALVILT


                         .         .         *         .         .         .         .:140
query           SAGGAVSKEWSPQIGAQGAVVIDNSSAWRMDPDVPLIVPEVNAAAAAGFTKKNIIANPNCSTAQLVVALK
1brmA2          ----------------------------------------------------------NCTVSLMLMSLG
2gyyA1          SAGSSTSAKYAPYAVKAGVVVVDNTSYFRQNPDVPLVVPEVNAHALD--AHNGIIACPNAAWNSVQIA-E
2gyyA2          -----------------------------------------------------------CSTIQMMVALE
2hjsA2          -----------------------------------------------------------CAVAELCEVLA
1b7gO2          -----------------------------------------------------------CNTTALLRTIC
1vknA1          ALPAGASYDLVREL--KGVKIIDLGADFRFDPGVYENLPELHREEIKN---AQVVGNPGLVKGASGQAVQ
1nvmB1          SASAHVQNEALLRQAKPGIRLIDLTPAAIG----PYCVPVVNLEEHLGKLNVNMVTYAGNLDIMTSAALA
2hjsA1          AAAAEVSRAHAERARAAGCSVIDLSGALEPSVAPPVXV--------------------------------
1brmA1          GGDYTNEIYPKLRESGWQGYWIDAASSLRMKDDAIIILDPVNQDVIT---DGLNNGIRTFVGGAAEPLRR
1jvsA2          ----------------------------------------------------------------------
1u1iA1          SNAYEAAKEHWELNRHFDREILEAVKSDLEGIVAR------KGTALNCGSGIKELGDIKTLEGEGLSLAE
1xq6A           SAVPKMKPGFDPKGGRPEFIFEDGQYPEQVDWIGQKNQ--IDAAKVAG----------------------


                         +         .         .         .         .         *         .:210
query           PLHDHAKITRVVVSTYQSVSGAGKEGMDELFSQTKAVYTNSELVNKKFPKRIAFNVIPEIDVFMEDGYTK
1brmA2          GLFANDLVDWVSVATYQAASGGGARHMRELLTQMGHLYRSGELPVDNFGVPLAGSLIPWID---------
2gyyA1          TLHERGLVRPTAELKFE-----------------------------------------------------
2gyyA2          PVRQKWGLDRIIVSTYQAVSGAGMGAILETQRELREVLNDGVKGGDKKHYPIAFNALPQIDVFTDNDYTY
2hjsA2          PLLATLDCRQLNLTACLSVSSLGREGVKELARQTAELLNARPLEPRLFDRQIAFNLLAQVGAVDAEGHSA
1b7gO2          TVNKVSKVEKVRATIVRRAADQKE--------------------VKKGPIN---SLVPDP----------
1vknA1          NXN-------------------------------------------------------------------
1nvmB1          TAERMAQSMLN-----------------------------------------------------------
2hjsA1          ----------------------------------------------------------------------
1brmA1          MLRQLA----------------------------------------------------------------
1jvsA2          ----------------------------------------------------------------------
1u1iA1          MVSRIEEDIKSFADDETVVINVASTEPLPNYSEEYH----------------------------------
1xq6A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           EEWKMMVETKKILDPAIKLSATCVRVPVFVGHSEAVNIEFENPITADEARDILRRSPGCLVIDKHEPGGY
1brmA2          --WKGQAETNKILNTVIPVDGLCVRVGALRCHSQAFTIKLKKDVSIPTVEELLAANPWAKVVDREITMRE
2gyyA1          ----------------------------------------------------------------------
2gyyA2          EEMKMTKETKKIMEDDIAVSATCVRIPVLSAHSESVYIETKEVAPIEEVKAAIAAFPGAVLEDDVAHQIY
2hjsA2          IERRIFAEVQALLERIGPLNVTCIQAPVFFGDSLSVTLQCAEPVDLAAVTRVLDATKGIEWVGEGDY--P
1b7gO2          ----ATVPSHNSVIRNLDIATMAVIAPTTLMHMHFINITLKDKVEKKDILSVLENTPRIVLISSKYD---
1vknA1          ----------------------------------------------------------------------
1nvmB1          ----------------------------------------------------------------------
2hjsA1          ----------------------------------------------------------------------
1brmA1          ----------------------------------------------------------------------
1jvsA2          ----------------------------------------------------------------------
1u1iA1          ----------------------------------------------------------------------
1xq6A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           VTPYEAAGEDATYISRIRTDPTVDNGLVLWCVSDNLRKGxxxxxxxxxxxxxxxxxxxxxxxxx
1brmA2          LTPAAVTGTLTTPVGRLRKLNMGPEFLSAFTVGDQLLWG-------------------------
2gyyA1          ----------------------------------------------------------------
2gyyA2          PQAINAVGSRDTFVGRIRKDLDAEKGIHMWVVSDNLLKG-------------------------
2hjsA2          TVVGDALGQDETYVGRVRAGQADPCQVNLWIVSDNVRKG-------------------------
1b7gO2          AEATAELVEVARDLKRDRND--------------------------------------------
1vknA1          ----------------------------------------------------------------
1nvmB1          ----------------------------------------------------------------
2hjsA1          ----------------------------------------------------------------
1brmA1          ----------------------------------------------------------------
1jvsA2          ----------------------------------------------------------------
1u1iA1          ----------------------------------------------------------------
1xq6A           ----------------------------------------------------------------