[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for rpal2:ABE38048.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1r8gA.bssp"

## Summary of PDB Search
:456
    5e-31  17%  1r8gA  [d.128.1.3] HYPOTHETICAL PROTEIN YBDK
:456

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxKPPSEFRIGTEHEKTPFTLEGHHPVPYAGARGIGALLEGMQLLLG
1r8gA           -------------------------HVSEPFTLGIELEXQVVNPPGYDLSQDS-----------------


                         .         .         *         .         .         .         .:140
query           WEPIMEGPHIIGLHDVTGGGAISLEPGGQFELSGAPLDNVHQTHAELMAHLAQVREVATPLGIGFLGLGM
1r8gA           -SXLIDA-----VKNKITAGEVKHDIESXLELATDVCRDINQAAGQFSAXQKVVLQAATDHHLEICGGGT


                         +         .         .         .         .         *         .:210
query           TPSWSREDIPVMPKGRYKIMTNYMPKVGSYGLDMMYRTCTVQTNLDFSSEADMVKKLRVSVALQPVATAL
1r8gA           HP---------FQKWNFGYLIQQAT------------VFGQHVHVGCASGDDAIYLLHGLSRFVPHFIAL


                         .         .         .         +         .         .         .:280
query           FANSPFTEGKPNGFLSFRSEIWRDTDNARSGMIPWAFEDGMGFERWVDYALDVPMYFVKRGDHYIDVSGS
1r8gA           SAASPYXQGTDTRFASSRPNIFSAFPDNG---PXPWVSNWQQFEALFRCLSYTTXI--------------


                         .         *         .         .         .         .         +:350
query           SFRDFFDGKNEKLPGERPTLSDWANHLSTIFPEVRLKRYLEMRGADGVPWGRLPALPAFWVGLLYDDTSL
1r8gA           ---------------------DSIKDLHWDIRPSPHFGTVEVRVXDTPLTLSHAVNXAGLIQATAHWLLT


                         .         .         .         .         *         .         .:420
query           DAAWEIVKGWDASERQALRDDVPRLGFKARIGNRFLFEIARECLVLAHAGLRRRGRIDGFGHDETRHLAA
1r8gA           ERPFKHQE-KDYLLYKFNRFQACRYGLEGVIDRRPLTEDTLRLLEKIAPSAHKIG--------ASSAIEA


                         .         .         +         .         .         .         .:490
query           LDQILDAGRTPAEEMLEKFDGAWRGSVEPAYDEYAx
1r8gA           LHRQVVSGLNEAQLXRDFVGGSLIGLVKKHCEIWA-