[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for rpal2:ABE38106.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1w25A3.bssp"
#ERROR : Can't open dsspfile "3byqA1.bssp"
#ERROR : Can't open dsspfile "1wc0A.bssp"
#ERROR : Can't open dsspfile "1azsA.bssp"
#ERROR : Can't open dsspfile "2p7jA2.bssp"
#ERROR : Can't open dsspfile "3by8A1.bssp"

## Summary of PDB Search
:494
    2e-29  35%  1w25A3 [d.58.29.2] STALKED-CELL DIFFERENTIATION CONTROLLING PROTEIN
    2e-22  13%  3byqA1 [d.79.9.1] UNCHARACTERIZED PROTEIN DUF1185 A:2 -- 192
    2e-15  10%  1wc0A  [d.58.29.1] ADENYLATE CYCLASE
    3e-15   9%  1azsA  [d.58.29.1] VC1
    6e-11  11%  2p7jA2 [d.110.6.2] PUTATIVE SENSORY BOX/GGDEF FAMILY PROTEIN A:9 --
    1e-08  12%  3by8A1 [d.110.6.1] SENSOR PROTEIN DCUS A:46 -- 178
:494

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxNAQELARQTQENLASTISADINRNIEAYDL
1w25A3          ----------------------------------------------------------------------
3byqA1          ----------------------------------------------------------------------
1wc0A           ----------------------------------------------------------------------
1azsA           ----------------------------------------------------------------------
2p7jA2          ----------------------------------------NNVENTAKEALHQLAYTGREYNNIQDQIET
3by8A1          ------------------------------------------------------------TRDGLANKAL


                         .         .         *         .         .         .         .:140
query           SLRSVVSNLALPQLAHVDETLRRLILFDHASIARHFGSIQVFDAQGNLTIDSATLTPEKLNRGDEPFVSA
1w25A3          ----------------------------------------------------------------------
3byqA1          ----------------------------------------------------------------------
1wc0A           ----------------------------------------------------------------------
1azsA           ----------------------------------------------------------------------
2p7jA2          ISDLLGHSQSLYDLREPSKANLTILENXWSSVARNYKQIRFLDTSGTEKVRIAGPSLILRDKSAREYFKY
3by8A1          AVARTLADSPRQGLQKKPQESGIQAIAEAVRKRNDLLFIVVTDMQSLRYSHP-EAQRIGQPFKGDDILKA


                         +         .         .         .         .         *         .:210
query           HRDDPTVGLYISRPMQHRGTFAIVLSRRISGTDGRFLGVVAGSIRFSYFKQVFSxxxxxxxxxxxxxxxx
1w25A3          ----------------------------------------------------------------------
3byqA1          ----------------------------------------------------------------------
1wc0A           ----------------------------------------------------------------------
1azsA           ----------------------------------------------------------------------
2p7jA2          AQSLDNEQISAWGIELERDKGELVYPLSPSLRNDVRQGYLVLNVDIEYLSSLL-----------------
3by8A1          LNGEENVAINRGF-----LAQALRVFTPIYDENHKQIGVVAIGLELSRVTQQIN----------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1w25A3          ----------------------------------------------------------------------
3byqA1          ----------------------------------------------------------------------
1wc0A           ----------------------------------------------------------------------
1azsA           ----------------------------------------------------------------------
2p7jA2          ----------------------------------------------------------------------
3by8A1          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxSLTGLINRRKFDTLIEREWRRA
1w25A3          -------------------------------------------------LTGLHNRRYMTGQLDSLVKRA
3byqA1          ------------------------------------------------SLIEIRKRTLIVETTYHENGPA
1wc0A           --------------------------------------------------------------------HM
1azsA           ---------------------------------------------------------------DMFHKIY
2p7jA2          ----------------------------------------------------------------------
3by8A1          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           LRMNTPIALLIIDADHFKAFNDGYGHQAGDQVLVGIALCIGDSVQRAGDCAARFGGEEFAVLLPGGSATA
1w25A3          TLGGDPVSALLIDIDFFKKINDTFGHDIGDEVLREFALRLASNV-RAIDLPCRYGGEEFVVIMPDTALAD
3byqA1          VIRNPYAGRYEPDLXPFXAELRSLGTLLATELVDTLGKDNIEVY-SKAAIVGVDGEXEHGAVWHEAGGWA
1wc0A           RPEPRLITILFSDIVGFTRMSNALQSQGVAELLNEYLGEMTRAVFENQGTVDKFVGDAIMALYGAPEEMS
1azsA           IQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARA
2p7jA2          ----------------------------------------------------------------------
3by8A1          ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           AQGVAETIRNKVAHWSVGQGDVTVSIGVASMTPAPGQHWPVLFEXXXXXXXXXXXXGRNCCVVAASRHDx
1w25A3          ALRIAERIRMHVSTVAHGREMLNVTISIGVSAAGEGDTPEALLKRADEGVYQAKASGRNAVVGKAA----
3byqA1          XRSVLGEPKAXVP-----AVKAVATAGYRXXVPVHYIHASYVRSHFNSIEIGIQDAPRPREILFALVXG-
1wc0A           PSEQVRRAIATARQMLVALEKLNQGWQERGLVGRNEVP--------------------------------
1azsA           DHAHCCVEMGMDMIEAISLVREMTGVNV------------------------------------------
2p7jA2          ----------------------------------------------------------------------
3by8A1          ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxx
1w25A3          ----
3byqA1          ----
1wc0A           ----
1azsA           ----
2p7jA2          ----
3by8A1          ----