[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for rpal2:ABE38119.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2itbA1.bssp"
#ERROR : Can't open dsspfile "2oc5A1.bssp"
#ERROR : Can't open dsspfile "1otkA.bssp"
#ERROR : Can't open dsspfile "1fyzC.bssp"

## Summary of PDB Search
:496
    8e-16  13%  2itbA1 [a.25.1.7] TRNA-(MS(2)IO(6)A)-HYDROXYLASE, PUTATIVE A:3 --
    4e-12  12%  2oc5A1 [a.25.1.6] HYPOTHETICAL PROTEIN A:20 -- 241
    3e-11  15%  1otkA  [a.25.1.2] PHENYLACETIC ACID DEGRADATION PROTEIN PAAC
    2e-07  10%  1fyzC  [a.25.1.2] METHANE MONOOXYGENASE COMPONENT A, BETA CHAIN
:496

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxWHPGYIDWWNDMGPEGFQQSLVYLR
2itbA1          ----------------------------------------------------------------------
2oc5A1          ----------------------------------------------------------------------
1otkA           ----------------------------------------------------------------------
1fyzC           ---------------------------------------------WIAGGL-DWGDWTQKFHGGRPSWGN


                         .         .         *         .         .         .         .:140
query           TAYSVDPRGWAKFDYVKMPDYRWGVLLAPQEENRTIPFGEHYGEPAWQEVPGEYRAMLRRLIVIQGDTEP
2itbA1          ------------------------------------EIDAFLGCPTPDAWIEAALADQETLLIDHKNCEF
2oc5A1          -------------------------------------------EALPDFTSDRYKDAYSRINAIVIEGEQ
1otkA           ---------------------------------------------------------LTAYTLRLGDNCL
1fyzC           ETTELRTVDWFKHRDPLRRWHAPYVKDKAEEWRYTLQGYSAD-GQIRAMNPTWRDEFINRYWGAFLFNEY


                         +         .         .         .         .         *         .:210
query           ASVEQQRHLGKTAPSLYDMRNLFQVNVEEGRHLWAMVYLLQKYFGRDGREEADDLLRRRSGDADSPRMLG
2itbA1          KAASTALSLIAKYNTHLDLINXXRLAREELVHHEQVLRLXKRRGVPLRPVSAGRYASG--------LRRL
2oc5A1          EAHDNYIAIGTLLPDHVEE--LKRLAKXEXRHKKGFTACGKNLGVEADXDFAREFFAPLRDNFQ------
1otkA           VLSQRLGEWCGHAPELEIDLALANIGLDLLGQAR-NFLSYAAELAGEGDEDTLAFTR----DERQFSNLL
1fyzC           GLFNAHSQGAREALSDVTRVSLAFWGFDKIDIAQMIQLERGFLAKIVGFDESTAVPKAEWTNGEVYKSAR


                         .         .         .         +         .         .         .:280
query           AFNEATPDWLSFFMFTYFTDRDGKMQLHSLAQSGFDPLSRTCRFMLTEEAHHMFVGETGISRIVQRTCEA
2itbA1          VRAHEPVKLVDTLVVGAFIEARSCERFAALVPHLDEELGRFYHGLLKSEARHYQGYLKLAHNYGDEADIA
2oc5A1          TALGQGKTPTCLLIQALLIEAFAISAYHTYIPVSDPFARKITEGVVKDEYTHLNYGEAWLKAN----LES
1otkA           LVEQPNGNFADTIARQYFIDAWHVALFTRLMESRDPQLAAISAKAIKEARYHLRFSRGWLERLGNGTDVS
1fyzC           LAVEEVFDWNESAFSVHAVYDALFGQFREFFQRLAPRTPFFINQAQTYFQIAKQGVQDLYYNCLGDDPE-


                         .         *         .         .         .         .         +:350
query           MRDAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2itbA1          RCVE------------------------------------------------------------------
2oc5A1          CRE-------------------------------------------------------------------
1otkA           GQ--------------------------------------------------------------------
1fyzC           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2itbA1          ----------------------------------------------------------------------
2oc5A1          ----------------------------------------------------------------------
1otkA           ----------------------------------------------------------------------
1fyzC           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2itbA1          ----------------------------------------------------------------------
2oc5A1          ----------------------------------------------------------------------
1otkA           ----------------------------------------------------------------------
1fyzC           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxx
2itbA1          ------
2oc5A1          ------
1otkA           ------
1fyzC           ------