[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for rpal2:ABE38168.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1efpB.bssp"
#ERROR : Can't open dsspfile "1o94C.bssp"
#ERROR : Can't open dsspfile "1o94D.bssp"
#ERROR : Can't open dsspfile "2ozgA1.bssp"
#ERROR : Can't open dsspfile "1al7A.bssp"

## Summary of PDB Search
:249
    1e-62  74%  1efpB  [c.26.2.3] PROTEIN (ELECTRON TRANSFER FLAVOPROTEIN)
    9e-46  33%  1o94C  [c.26.2.3] ELECTRON TRANSFER FLAVOPROTEIN BETA-SUBUNIT
    3e-28  18%  1o94D  [c.26.2.3] ELECTRON TRANSFER FLAVOPROTEIN ALPHA-SUBUNIT
    4e-26  17%  2ozgA1 [d.106.1.4] GCN5-RELATED N-ACETYLTRANSFERASE A:291 -- 395
    5e-12  17%  1al7A  [c.1.4.1] GLYCOLATE OXIDASE
:249

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKVLVPVKRVVDYNVKIRVKSDGSGVELTNVKMSMNPFDEIAVEEALRLKEAGKATEVVVVSIGPAQASE
1efpB           MKVLVPVKRLIDYNVKARVKSDGSGVDLANVKMSMNPFDEIAVEEAIRLKEKGQAEEIIAVSIGVKQAAE
1o94C           MKILVAVKQTAALEEDFEIRDGM-DVDEDFMMYDLNEWDDFSLEEAMKIKESSDDVEVVVVSVGPDRVDE
1o94D           ------------------------LVIAEHRRNDLRPVSLELIGAANGLKKSGED-KVVVAVIGS-QADA
2ozgA1          ----------------------------------------------------------------------
1al7A           TSLPILVKGVITAEDARLAVQHGAAGIIVSNHGARQLDYVPATIMALEEVVKAAQGRIPVFLDGGVRRGT


                         .         .         *         .         .         .         .:140
query           TLRTGLAMGADRGILVKAEGTVEPLAVAKILKAIADEEQPGLIILGKQAIDDDSNQTGQMLAALLGWAQA
1efpB           TLRTALAMGADRAILVVAADDIEPLAVAKILAAVARAEGTELIIAGKQAIDNDMNATGQMLAAILGWAQA
1o94C           SLRKCLAKGADRAVRVWDDAAEGAIVVGRILTEVIKKEAPDMVFAGVQSSDQAYASTGISVASYLNWPHA
1o94D           FVPALSVNGVDELVVVKSSIDFDPDVFEASVSALIAAHNPSVVLLPHSVDSLG---YASSLASKTGYGFA
2ozgA1          -----------------------------------------KALEARGPLGVEAELHLEVQDDLLATNQG
1al7A           DVFKALALGAAGRPVVFSLAAEGEAGVKKVLQMMRDEFELTMALSGCRSLKE---ISRSHIAADW-----


                         +         .         .         .         .         *         .:210
query           TFASKLEVEGSDFTVSREVDGGSQTVKLKGPAIVTTDLRLNEPRYASLPNIMKAKKKPIAEKTADQYGVD
1efpB           TFASKVEIEGAKAKVTREVDGGLQTIAVSLPAVVTADLRLNEPRYASLPNIMKAKKKPLDEKTAADYGVD
1o94C           AVVADLQYKPGDNVIRRELEGGLQEVEINCPAVLTIQLGINKPRYASLRGIKQAATKPIEEVSLADIGLS
1o94D           TDVYIVEYQGDELVATRGGYNQKVNVEVDSTVVLTIRPSVFKPLEGAGSPVVSNVDAPSVQSRSQNKDY-
2ozgA1          KFI--LSVANGKSEVTKGGKGELQLDIKGLASLYTSL---FTPRQLQLTGKLQATETALLKATQIFAGES
1al7A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           LAPRLEVLKTVEPSGRKAGVKVKDVAELVSKLxxxxxxx
1efpB           VAPRLEVVSVREPEGRKAGIKVGSVDELVGKL-------
1o94C           ANSMSRVRRMYIP--------------------------
1o94D           ---------------------------------------
2ozgA1          ---------------------------------------
1al7A           ---------------------------------------