[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for rpal2:ABE38181.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1sgwA.bssp"
#ERROR : Can't open dsspfile "1b0uA.bssp"
#ERROR : Can't open dsspfile "1ji0A.bssp"
#ERROR : Can't open dsspfile "1mukA.bssp"
#ERROR : Can't open dsspfile "1e69A.bssp"
#ERROR : Can't open dsspfile "1ex6A.bssp"
#ERROR : Can't open dsspfile "1pf4A1.bssp"
#ERROR : Can't open dsspfile "1l7vC.bssp"
#ERROR : Can't open dsspfile "1e9rA.bssp"
#ERROR : Can't open dsspfile "1q3hA.bssp"
#ERROR : Can't open dsspfile "1m3eA1.bssp"
#ERROR : Can't open dsspfile "1ohcA1.bssp"
#ERROR : Can't open dsspfile "2yyeA2.bssp"
#ERROR : Can't open dsspfile "1qhlA.bssp"
#ERROR : Can't open dsspfile "1urjA.bssp"
#ERROR : Can't open dsspfile "1khbA1.bssp"
#ERROR : Can't open dsspfile "1bgxT2.bssp"
#ERROR : Can't open dsspfile "1nijA1.bssp"
#ERROR : Can't open dsspfile "2gx8A1.bssp"
#ERROR : Can't open dsspfile "2gk3A1.bssp"
#ERROR : Can't open dsspfile "1s9hA.bssp"
#ERROR : Can't open dsspfile "1tljA.bssp"
#ERROR : Can't open dsspfile "2f9hA1.bssp"
#ERROR : Can't open dsspfile "1mjgM.bssp"
#ERROR : Can't open dsspfile "1mm8A.bssp"
#ERROR : Can't open dsspfile "1f46A.bssp"
#ERROR : Can't open dsspfile "1f2t.1.bssp"
#ERROR : Can't open dsspfile "1bccF.bssp"
#ERROR : Can't open dsspfile "1n25A.bssp"
#ERROR : Can't open dsspfile "1t06A.bssp"
#ERROR : Can't open dsspfile "1zs3A1.bssp"
#ERROR : Can't open dsspfile "1bmfA3.bssp"
#ERROR : Can't open dsspfile "1pv4A3.bssp"
#ERROR : Can't open dsspfile "1j1zA2.bssp"
#ERROR : Can't open dsspfile "1c4oA1.bssp"
#ERROR : Can't open dsspfile "1zp6A1.bssp"
#ERROR : Can't open dsspfile "1es6A2.bssp"
#ERROR : Can't open dsspfile "2qgmA1.bssp"
#ERROR : Can't open dsspfile "1jbkA.bssp"
#ERROR : Can't open dsspfile "1rkbA.bssp"
#ERROR : Can't open dsspfile "1i1qA.bssp"
#ERROR : Can't open dsspfile "2vgmA3.bssp"
#ERROR : Can't open dsspfile "1l3aA.bssp"
#ERROR : Can't open dsspfile "1jjvA.bssp"
#ERROR : Can't open dsspfile "1t3wA.bssp"
#ERROR : Can't open dsspfile "1jalA1.bssp"
#ERROR : Can't open dsspfile "1xbtA1.bssp"
#ERROR : Can't open dsspfile "1ffhA2.bssp"
#ERROR : Can't open dsspfile "2fggA1.bssp"
#ERROR : Can't open dsspfile "3cddA1.bssp"
#ERROR : Can't open dsspfile "2iqhA1.bssp"
#ERROR : Can't open dsspfile "2v3jA1.bssp"
#ERROR : Can't open dsspfile "1e6cA.bssp"
#ERROR : Can't open dsspfile "1g6hA.bssp"
#ERROR : Can't open dsspfile "1viaA.bssp"
#ERROR : Can't open dsspfile "1bs2A1.bssp"
#ERROR : Can't open dsspfile "1d6jA.bssp"
#ERROR : Can't open dsspfile "1dhyA1.bssp"
#ERROR : Can't open dsspfile "1gm5A1.bssp"
#ERROR : Can't open dsspfile "2axpA1.bssp"
#ERROR : Can't open dsspfile "1cd5A.bssp"
#ERROR : Can't open dsspfile "1poiA.bssp"
#ERROR : Can't open dsspfile "1f8xA.bssp"
#ERROR : Can't open dsspfile "1udwA.bssp"
#ERROR : Can't open dsspfile "1kgdA.bssp"
#ERROR : Can't open dsspfile "2pa7A1.bssp"
#ERROR : Can't open dsspfile "1ii8.1.bssp"
#ERROR : Can't open dsspfile "1t9hA2.bssp"
#ERROR : Can't open dsspfile "1o7d.2.bssp"
#ERROR : Can't open dsspfile "1qhdA1.bssp"
#ERROR : Can't open dsspfile "1jb1A.bssp"
#ERROR : Can't open dsspfile "1mi8A.bssp"
#ERROR : Can't open dsspfile "1atrA1.bssp"
#ERROR : Can't open dsspfile "1puoA2.bssp"
#ERROR : Can't open dsspfile "1grqA.bssp"
#ERROR : Can't open dsspfile "1xl3C1.bssp"
#ERROR : Can't open dsspfile "1ovmA2.bssp"
#ERROR : Can't open dsspfile "1d8jA.bssp"
#ERROR : Can't open dsspfile "1afrA.bssp"
#ERROR : Can't open dsspfile "1g6oA.bssp"
#ERROR : Can't open dsspfile "1dnpA2.bssp"
#ERROR : Can't open dsspfile "1l7lA.bssp"
#ERROR : Can't open dsspfile "1cr0A.bssp"
#ERROR : Can't open dsspfile "1v47A1.bssp"
#ERROR : Can't open dsspfile "2gtlM1.bssp"
#ERROR : Can't open dsspfile "1vplA.bssp"
#ERROR : Can't open dsspfile "1fl9A.bssp"
#ERROR : Can't open dsspfile "1ni3A1.bssp"
#ERROR : Can't open dsspfile "3cddA2.bssp"
#ERROR : Can't open dsspfile "1np6A.bssp"
#ERROR : Can't open dsspfile "1em8A.bssp"
#ERROR : Can't open dsspfile "1yvuA2.bssp"
#ERROR : Can't open dsspfile "1g8yA.bssp"
#ERROR : Can't open dsspfile "1vhhA.bssp"
#ERROR : Can't open dsspfile "1w1wA.bssp"
#ERROR : Can't open dsspfile "1ak2A1.bssp"
#ERROR : Can't open dsspfile "1lw7A2.bssp"
#ERROR : Can't open dsspfile "1iqrA2.bssp"
#ERROR : Can't open dsspfile "1ckvA.bssp"
#ERROR : Can't open dsspfile "2gujA1.bssp"
#ERROR : Can't open dsspfile "1jqjA3.bssp"
#ERROR : Can't open dsspfile "1b77A2.bssp"
#ERROR : Can't open dsspfile "1e3mA2.bssp"
#ERROR : Can't open dsspfile "1sbxA.bssp"
#ERROR : Can't open dsspfile "1oa8A.bssp"
#ERROR : Can't open dsspfile "1iioA.bssp"
#ERROR : Can't open dsspfile "1v37A.bssp"
#ERROR : Can't open dsspfile "1g8fA3.bssp"
#ERROR : Can't open dsspfile "1q3tA.bssp"
#ERROR : Can't open dsspfile "1yj5A2.bssp"
#ERROR : Can't open dsspfile "1tueA.bssp"
#ERROR : Can't open dsspfile "2vnuD1.bssp"
#ERROR : Can't open dsspfile "1esmA.bssp"
#ERROR : Can't open dsspfile "1a4iA2.bssp"
#ERROR : Can't open dsspfile "1g31A.bssp"
#ERROR : Can't open dsspfile "1ckeA.bssp"
#ERROR : Can't open dsspfile "2je6I3.bssp"
#ERROR : Can't open dsspfile "2bsqE1.bssp"
#ERROR : Can't open dsspfile "1xkpA1.bssp"
#ERROR : Can't open dsspfile "1yr6A1.bssp"
#ERROR : Can't open dsspfile "1pgsA2.bssp"

## Summary of PDB Search
:219
    3e-33  16%  1sgwA  [c.37.1.12] PUTATIVE ABC TRANSPORTER
    6e-31  32%  1b0uA  [c.37.1.12] HISTIDINE PERMEASE
    3e-26  25%  1ji0A  [c.37.1.12] ABC TRANSPORTER
    4e-26  17%  1mukA  [e.8.1.4] MINOR CORE PROTEIN LAMBDA 3
    1e-24  15%  1e69A  [c.37.1.12] CHROMOSOME SEGREGATION SMC PROTEIN
    7e-23  11%  1ex6A  [c.37.1.1] GUANYLATE KINASE
    9e-23  25%  1pf4A1 [c.37.1.12] TRANSPORT ATP-BINDING PROTEIN MSBA A:321 -- 564
    1e-22  25%  1l7vC  [c.37.1.12] VITAMIN B12 TRANSPORT ATP-BINDING PROTEIN BTUD
    1e-22   9%  1e9rA  [c.37.1.11] CONJUGAL TRANSFER PROTEIN TRWB
    1e-22  18%  1q3hA  [c.37.1.12] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-22   9%  1m3eA1 [c.124.1.2] SUCCINYL-COA:3-KETOACID-COENZYME A TRANSFERASE
    2e-22  11%  1ohcA1 [c.45.1.1] CDC14B2 PHOSPHATASE A:42 -- 198
    4e-20   7%  2yyeA2 [d.139.1.1] SELENIDE, WATER DIKINASE A:155 -- 336
    1e-19  13%  1qhlA  [c.37.1.12] PROTEIN (CELL DIVISION PROTEIN MUKB)
    2e-19   9%  1urjA  [e.58.1.1] MAJOR DNA-BINDING PROTEIN
    2e-18   6%  1khbA1 [c.91.1.1] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    2e-18  17%  1bgxT2 [c.120.1.2] TAQ DNA POLYMERASE T:1 -- 173
    4e-18  11%  1nijA1 [c.37.1.10] HYPOTHETICAL PROTEIN YJIA A:2 -- 223
    8e-18   6%  2gx8A1 [c.135.1.1] NIF3-RELATED PROTEIN A:4 -- 373
    6e-17   9%  2gk3A1 [c.23.16.9] PUTATIVE CYTOPLASMIC PROTEIN A:8 -- 253
    8e-17   8%  1s9hA  [c.37.1.20] REP 40 PROTEIN
    2e-16  10%  1tljA  [d.282.1.1] HYPOTHETICAL UPF0130 PROTEIN SSO0622
    2e-16  10%  2f9hA1 [b.161.1.1] PTS SYSTEM, IIA COMPONENT A:3 -- 123
    6e-16   7%  1mjgM  [e.26.1.3] CARBON MONOXIDE DEHYDROGENASE ALPHA SUBUNIT
    7e-16  14%  1mm8A  [c.55.3.4] TN5 TRANSPOSASE
    9e-16   8%  1f46A  [d.129.4.1] CELL DIVISION PROTEIN ZIPA
    1e-15  23%  1f2t.1 [c.37.1.12] RAD50 ABC-ATPASE A:- -- - B:- -- -
    1e-15  12%  1bccF  [f.27.1.1] UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
    1e-15  13%  1n25A  [c.37.1.20] LARGE T ANTIGEN
    3e-15   6%  1t06A  [a.118.1.17] HYPOTHETICAL PROTEIN
    4e-15  13%  1zs3A1 [a.25.1.1] LACTOCOCCUS LACTIS MG1363 DPSA A:3 -- 173
    5e-15   8%  1bmfA3 [c.37.1.11] BOVINE MITOCHONDRIAL F1-ATPASE A:95 -- 379
    6e-15  13%  1pv4A3 [c.37.1.11] TRANSCRIPTION TERMINATION FACTOR RHO A:129 --
    7e-15  10%  1j1zA2 [d.210.1.1] ARGININOSUCCINATE SYNTHETASE A:171 -- 395
    8e-15  11%  1c4oA1 [c.37.1.19] DNA NUCLEOTIDE EXCISION REPAIR ENZYME UVRB A:2
    9e-15   7%  1zp6A1 [c.37.1.25] HYPOTHETICAL PROTEIN ATU3015 A:6 -- 181
    9e-15   9%  1es6A2 [b.31.1.1] MATRIX PROTEIN VP40 A:201 -- 321
    1e-14  10%  2qgmA1 [c.150.1.3] SUCCINOGLYCAN BIOSYNTHESIS PROTEIN A:33 -- 445
    3e-14  15%  1jbkA  [c.37.1.20] CLPB PROTEIN
    3e-14  10%  1rkbA  [c.37.1.1] PROTEIN AD-004
    4e-14  12%  1i1qA  [d.161.1.1] ANTHRANILATE SYNTHASE COMPONENT I
    4e-14  10%  2vgmA3 [d.79.3.2] DOM34 A:278 -- 381
    4e-14  15%  1l3aA  [d.18.1.2] P24: PLANT TRANSCRIPTIONAL REGULATOR PBF-2
    5e-14  13%  1jjvA  [c.37.1.1] DEPHOSPHO-COA KINASE
    8e-14  11%  1t3wA  [a.236.1.1] DNA PRIMASE
    9e-14  10%  1jalA1 [c.37.1.8] YCHF PROTEIN A:1 -- 278
    1e-13  10%  1xbtA1 [c.37.1.24] THYMIDINE KINASE, CYTOSOLIC A:18 -- 150
    1e-13  14%  1ffhA2 [c.37.1.10] FFH A:89 -- 295
    2e-13  15%  2fggA1 [d.50.5.1] HYPOTHETICAL PROTEIN RV2632C/MT2708 A:4 -- 87
    2e-13   8%  3cddA1 [b.106.1.1] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN A:181 -- 348
    5e-13   8%  2iqhA1 [e.75.1.1] NUCLEOCAPSID PROTEIN A:21 -- 489
    6e-13   9%  2v3jA1 [c.116.1.6] ESSENTIAL FOR MITOTIC GROWTH 1 A:23 -- 251
    9e-13  16%  1e6cA  [c.37.1.2] SHIKIMATE KINASE
    1e-12  21%  1g6hA  [c.37.1.12] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID
    1e-12  10%  1viaA  [c.37.1.2] SHIKIMATE KINASE
    2e-12  12%  1bs2A1 [a.27.1.1] PROTEIN (ARGINYL-TRNA SYNTHETASE) A:484 -- 607
    3e-12  10%  1d6jA  [c.37.1.4] ADENOSINE-5'PHOSPHOSULFATE KINASE
    4e-12  10%  1dhyA1 [d.32.1.3] 2,3-DIHYDROXYBIPHENYL 1,2-DIOXYGENASE A:1 -- 132
    4e-12   4%  1gm5A1 [a.24.21.1] RECG A:7 -- 105
    4e-12  11%  2axpA1 [c.37.1.1] HYPOTHETICAL PROTEIN BSU20280 A:2 -- 165
    5e-12   9%  1cd5A  [c.124.1.1] PROTEIN (GLUCOSAMINE 6-PHOSPHATE DEAMINASE)
    7e-12  11%  1poiA  [c.124.1.2] GLUTACONATE COENZYME A-TRANSFERASE
    7e-12   3%  1f8xA  [c.23.14.1] NUCLEOSIDE 2-DEOXYRIBOSYLTRANSFERASE
    9e-12   8%  1udwA  [c.37.1.6] URIDINE-CYTIDINE KINASE 2
    1e-11   7%  1kgdA  [c.37.1.1] PERIPHERAL PLASMA MEMBRANE CASK
    1e-11  10%  2pa7A1 [b.82.1.1] DTDP-6-DEOXY-3,4-KETO-HEXULOSE ISOMERASE A:2 --
    1e-11  17%  1ii8.1 [c.37.1.12] RAD50 ABC-ATPASE A:- -- - B:- -- -
    1e-11  13%  1t9hA2 [c.37.1.8] PROBABLE GTPASE ENGC A:68 -- 298
    3e-11  16%  1o7d.2 [b.30.5.6] LYSOSOMAL ALPHA-MANNOSIDASE C:488 -- 585 D:603 --
    3e-11  10%  1qhdA1 [a.115.1.2] VIRAL CAPSID VP6 A:1 -- 148 A:333 -- 397
    3e-11  10%  1jb1A  [c.91.1.2] HPRK PROTEIN
    3e-11   7%  1mi8A  [b.86.1.2] DNAB INTEIN
    3e-11  13%  1atrA1 [c.55.1.1] HEAT-SHOCK COGNATE 70 KD PROTEIN A:2 -- 188
    4e-11  19%  1puoA2 [a.101.1.1] MAJOR ALLERGEN I POLYPEPTIDE, FUSED CHAIN 2, A:5
    8e-11   9%  1grqA  [c.37.1.3] CHLORAMPHENICOL 3-O PHOSPHOTRANSFERASE
    2e-10  13%  1xl3C1 [a.243.1.1] PROTEIN TYPE A C:2 -- 92
    3e-10  12%  1ovmA2 [c.36.1.5] INDOLE-3-PYRUVATE DECARBOXYLASE A:3 -- 180
    3e-10  13%  1d8jA  [a.4.5.18] GENERAL TRANSCRIPTION FACTOR TFIIE-BETA
    4e-10   9%  1afrA  [a.25.1.2] DELTA9 STEAROYL-ACYL CARRIER PROTEIN DESATURASE
    4e-10  12%  1g6oA  [c.37.1.11] CAG-ALPHA
    9e-10   7%  1dnpA2 [c.28.1.1] DNA PHOTOLYASE A:1 -- 200
    2e-09   6%  1l7lA  [b.18.1.16] PA-I GALACTOPHILIC LECTIN
    5e-09  15%  1cr0A  [c.37.1.11] DNA PRIMASE/HELICASE
    5e-09  13%  1v47A1 [b.122.1.3] ATP SULFURYLASE A:4 -- 135
    5e-09   4%  2gtlM1 [b.61.7.1] HEMOGLOBIN LINKER CHAIN L1 M:102 -- 225
    6e-09  25%  1vplA  [c.37.1.12] ABC TRANSPORTER, ATP-BINDING PROTEIN
    6e-09  19%  1fl9A  [c.37.1.18] HYPOTHETICAL PROTEIN HI0065
    6e-09  10%  1ni3A1 [c.37.1.8] YCHF GTP-BINDING PROTEIN A:11 -- 306
    7e-09   8%  3cddA2 [b.106.1.1] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN A:2 -- 180
    7e-09  14%  1np6A  [c.37.1.10] MOLYBDOPTERIN-GUANINE DINUCLEOTIDE BIOSYNTHESIS
    9e-09  16%  1em8A  [c.128.1.1] DNA POLYMERASE III CHI SUBUNIT
    2e-08  16%  1yvuA2 [c.55.3.10] HYPOTHETICAL PROTEIN AQ_1447 A:315 -- 706
    2e-08  13%  1g8yA  [c.37.1.11] REGULATORY PROTEIN REPA
    2e-08  15%  1vhhA  [d.65.1.2] SONIC HEDGEHOG
    3e-08  19%  1w1wA  [c.37.1.12] STRUCTURAL MAINTENANCE OF CHROMOSOME 1
    3e-08  12%  1ak2A1 [c.37.1.1] ADENYLATE KINASE ISOENZYME-2 A:14 -- 146 A:177 --
    4e-08   9%  1lw7A2 [c.37.1.1] TRANSCRIPTIONAL REGULATOR NADR A:220 -- 411
    1e-07  14%  1iqrA2 [c.28.1.1] PHOTOLYASE A:2 -- 171
    2e-07   7%  1ckvA  [d.137.1.1] PROTEIN (PROTEIN B)
    2e-07  12%  2gujA1 [b.106.1.3] PHAGE-LIKE ELEMENT PBSX PROTEIN XKDM A:5 -- 143
    2e-07   9%  1jqjA3 [d.131.1.1] DNA POLYMERASE III, BETA CHAIN A:245 -- 366
    6e-07  11%  1b77A2 [d.131.1.2] PROTEIN (SLIDING CLAMP) A:111 -- 228
    7e-07  13%  1e3mA2 [c.37.1.12] DNA MISMATCH REPAIR PROTEIN MUTS A:567 -- 800
    8e-07  13%  1sbxA  [a.6.1.4] SKI ONCOGENE
    9e-07  11%  1oa8A  [b.145.1.1] ATAXIN-1
    4e-06   7%  1iioA  [a.39.4.1] CONSERVED HYPOTHETICAL PROTEIN MTH865
    9e-06  14%  1v37A  [c.60.1.1] PHOSPHOGLYCERATE MUTASE
    2e-05  10%  1g8fA3 [c.37.1.15] SULFATE ADENYLYLTRANSFERASE A:390 -- 511
    3e-05  16%  1q3tA  [c.37.1.1] CYTIDYLATE KINASE
    3e-05  16%  1yj5A2 [c.37.1.1] 5' POLYNUCLEOTIDE KINASE-3' PHOSPHATASE A:351 --
    3e-05  12%  1tueA  [c.37.1.20] REPLICATION PROTEIN E1
    4e-05   9%  2vnuD1 [b.40.4.5] EXOSOME COMPLEX EXONUCLEASE RRP44 D:400 -- 494
    5e-05   9%  1esmA  [c.37.1.6] PANTOTHENATE KINASE
    9e-05   9%  1a4iA2 [c.58.1.2] METHYLENETETRAHYDROFOLATE DEHYDROGENASE / A:2 --
    2e-04  10%  1g31A  [b.35.1.1] GP31
    3e-04  16%  1ckeA  [c.37.1.1] PROTEIN (CYTIDINE MONOPHOSPHATE KINASE)
    4e-04   8%  2je6I3 [d.51.1.1] EXOSOME COMPLEX RNA-BINDING PROTEIN 1 I:153 --
    4e-04  16%  2bsqE1 [a.43.1.8] TRAFFICKING PROTEIN A E:2 -- 70
    5e-04  13%  1xkpA1 [a.243.1.3] PUTATIVE MEMBRANE-BOUND YOP TARGETING PROTEIN
    7e-04  11%  1yr6A1 [c.37.1.10] ATP(GTP)BINDING PROTEIN A:1 -- 244
    8e-04   6%  1pgsA2 [b.121.1.1] PEPTIDE-N(4)-(N-ACETYL-BETA-D-GLUCOSAMINYL)
:219

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MVRFENVGLRYGLGPEILRDLNFAIPAHSFQFLTGPSGAGKTXXXXXXXXXXXPTRGLVNLFGNDVSLLT
1sgwA           KLEIRDLSVGYD--KPVLERITMTIEKGNVVNFHGPNGIGKTTLLKTISTYLKPLKGEIIYNGVPIT---
1b0uA           KLHVIDLHKRYG-GHEVLKGVSLQARAGDVISIIGSSGSGKSTFLRCINFLEKPSEGAIIVNGQNINLVR
1ji0A           VLEVQSLHVYYG-AIHAIKGIDLKVPRGQIVTLIGANGAGKTTTLSAIAGLVRAQKGKIIFNGQDITNKP
1mukA           ---------------EMDETLMRARSYSSFSKLMCEAREPSVDLRLPLCAGIDPLNSDPFLKMVSVG---
1e69A           ----------------SFGRPSLIGFSDRVTAIVGPNGSGKSNIIDAIKWVFGEKFDMIFAGSENL---P
1ex6A           --------------------------------ISGPSGTGKSTLLKKLFAEYPDSFGFSVSSTTRTPRAG
1pf4A1          -VDVKDVTFTYQGKKPALSHVSFSIPQGKTVALVGRSGSGKSTIANLFTRFYDVDSGSICLDGHDVRDYK
1l7vC           --QLQDVAEST-----RLGPLSGEVRAGEILHLVGPNGAGKSTLLARXAGXT-SGKGSIQFAGQPLEAWS
1e9rA           -GKLKRMTREKA-KQVTVAGVPMPRDAEPRHLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGD---
1q3hA           LEKVSFSHLCLV-GNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGRVS---F
1m3eA1          -----------------AVEAVKDIPNGATVLVGGFGLCGIPENLIGALLKTGVKELTAVSNNAGVDNFG
1ohcA1          -----------------------------------------------------DPQDDVYLDITDRLCFA
2yyeA2          ---------------------QSGAQVGQLLILTKPIGTGILIKGLKEGILKEEDINEAIENMLALNDKA
1qhlA           -GKFRSLTLINW---NGFFARTFDLDEL-VTTLSGGNGAGKSTTMAAFVTALIPDLTLLLHGKLKAGVCY
1urjA           -TTGEALCERLGLDPDVTEGFKEAVCIN--NTFLHLGGSDKVTIGGAEVHRIPVYPLQLFMPDFSRVIAE
1khbA1          ----------LA-EHMLVLGITNPEGEKKYLAAAFPSACGKTNLAMMNPSLPGWKVECVGDDIAWMKFDA
1bgxT2          -------------------------------------------------------------------LFE
1nijA1          --------------------------------LTGFLGAGKTTLLRHILNEQHGYKIAVIENEFGEVSVD
2gx8A1          -------------------------------------------------------------------IPA
2gk3A1          ----------------------------------------------------------------------
1s9hA           ILELNGYDPQYAA-SVFLGWATKKFGKRNTIWLFGPATTGKTNIAEAIAHTVPFYGCVNWTNENF-----
1tljA           ----------EELREKALNKIYHDKEIGYLDPDILGFLLAFYRNRNDVYTQS-SCSGRITIVDAEMPWDR
2f9hA1          ----------------------------------------------------------------------
1mjgM           GIKLTKIKLDLP-INFGPAFEGESIRKGDMYVEMGGNRTPAFELVRTVSESEITDGKIEVIGPDIDQIPE
1mm8A           ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
1bccF           ---------------------------------------------------------------------S
1n25A           --------------------MVYNIPKKRYWLFKGPIDSGKTTLAAALLELCGGKALNVNLPLDRLNFEL
1t06A           -----------------VMQELEALGKERTKKIYISNGAHEPVFGVATGAMKPIAKKIKLNQE-----LA
1zs3A1          --------------------------------------------------------------------LM
1bmfA3          IIPRISVREPMQTGI-KAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKKKLYCIYV
1pv4A3          -ILFENLTPLHANSRLRVLDLASPIGRGQRGLIVAPPKAGKTXLLQNIAQSIAYNHPDCVLXVLLIDERP
1j1zA2          ----------------------------------------------------------------------
1c4oA1          -FRYRGPSPKGD-QPKAIAGLVEALRDGEFVTLLGATGTGKTVTMAKVIEALGRPALVLAPNKILA----
1zp6A1          --------------------------------LSGHPGSGKSTIAEALANLPGVPKVHFHSDDLWGYIKH
1es6A2          ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1jbkA           -ERAEQGKLDPVIGDEEIRRTVLQRRTKNNPVLIGEPGVGKTAIVEGLAQRIINGEVPEGLKGRRVLALD
1rkbA           --------------------------------LTGTPGVGKTTLGKELASKSGLKYINV-----GDLARE
1i1qA           VDRYSYVMHLVSVVGELRHDLDALHAYRACMNMGTLSGAPKVRAMQLIADAEGQRRGSYG----------
2vgmA3          ----------------------------------------------------------------------
1l3aA           ----------------------------------------------------------------------
1jjvA           --------------------------------LTGGIGSGKTTIANLFTDLGVPLVD-ADVVAREV--VA
1t3wA           -----------------------------------------------------PELATLVPPLENLD---
1jalA1          --------------------------------IVGLPNVGKSTLFNALTKAGPFCTIEPNTGVVPMPDPR
1xbtA1          --------------------------------ILGPMFSGKSTELMRRVRRFQIAQYKCLVIKYAK--DT
1ffhA2          -------------------ARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQRPA
2fggA1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
2iqhA1          ---NNGDDATAGLTHMMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGT--
2v3jA1          --------------PQAPPVLTSKDKITKRXIVVLAXASLET-HKIYVLLNCDDHQGLLKKXGRDISEAR
1e6cA           --------------------------------MVGARGCGMTTVGRELARALGYEFVDTDIFMQHTSGMT
1g6hA           ILRTENIVKYFG-EFKALDGVSISVNKGDVTLIIGPNGSGKSTLINVITGFLKADEG--RVYFENKDITN
1viaA           --------------------------------FIGFXGSGKSTLARALAKDLDLVFLDSDFLIEQKFNQK
1bs2A1          ----------------------------------------------------------------------
1d6jA           ----------------RSERTELRNQRGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDG-----
1dhyA1          ----------------------------------------------------------------------
1gm5A1          ----------------------------------------------------------------------
2axpA1          ----------------------------TLIILEGPDCCFKSTVAAKLSKELKYPIIKGSSFELAKSGNE
1cd5A           -VSFKHVVTFNMDEYVGLPKEHPESYYSFMHRNFFDHVDIPAENINLLNGNAPDIDAECRQYEEKIRSYG
1poiA           -----------------KDAIAKYVHSGDHIALGGFTTDRKPYAAVFEILRQGITTGLGGAAGGDWDMLI
1f8xA           ----------------------------------------------------------------------
1udwA           --------------------------------VSGGTASGKSSVCAKIVQLLQKQVVILSQDSFYRVLTS
1kgdA           --------------------------------LLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRP---P
2pa7A1          ----------------------------------------------------------------------
1ii8.1          ----------------------------------------------------------------------
1t9hA2          ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
1qhdA1          --------------SEYIENWNLQNRRQRTSVLADASETMLA-NVTSVRQEYAIPVGPVFPPGMNWT---
1jb1A           ---------------RSXHGVLVDIY-GLGVLITGDSGVGKSETALELVQRGHRLIADDRVDVYQQDEQT
1mi8A           RVSIKDLLDEKDFEIWAINEQTMKLESAKV-SRVFMTGKKLVYILKTRLGRTIKATANHRFLTIDGW---
1atrA1          ------------------KGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDA
1puoA2          --------------------------------------------------------------------PI
1grqA           --------------------------------LNGGSSAGKSGIVRCLQSVLPEPWLAFGVDSLIEAMP-
1xl3C1          ----------------------------------------------------------------------
1ovmA2          VIDSPDICWVGCANELASYAADGYARCKGFAALLTTFGVGELSAMNGIAGSYAEHVPVLHIVGAPGTAA-
1d8jA           ----------------------------------------------------------------------
1afrA           -------------PREVHVQVTHSMPPQKIEIFKSLDNWAEENILVHLKPVEKCWQPQDFLPDPASDGFD
1g6oA           FEEQGFYNLLDN-KEQAISAIKDGIAIGKNVIVCGGTGSGKTTYIKSIXEFIPKEERIISIEDTE-----
1dnpA2          ----------------------------------------------------------------------
1l7lA           ----------------WKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHP----
1cr0A           ----ESVGLLFS-GCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMG-----KKVGLAML
1v47A1          ----------------------------------------------------------------------
2gtlM1          -TITAAHRKSFFPNRVATLSYELDEHDHTVSTTQLRGFYNFGKRELLLAPLKGQSEGYG-VICDFNLGDD
1vplA           -VVVKDLRKRIG-KKEILKGISFEIEEGEIFGLIGPNGAGKTTTLRIISTLIKPSSGIVTVFGKNV----
1fl9A           -IPDEFSMLRFG-KKFAEILLKLHTEKAIMVYLNGDLGAGKTTLTRGML-------QGIGHQGNVKSPTY
1ni3A1          --------------------------------IVGXPNVGKSTFFRAITKSVLGNPANYPYATIDPEEAK
3cddA2          -LKAGGKIYQGWTKIRSLEAXSGAFDLEXTYKFLGNDAQYKAFIEPIKQGQACTVDIGGERVITGYVDDW
1np6A           ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1yvuA2          --------------------------------------------------------------------LL
1g8yA           -HKPINILEAFAAAPPPLDYVLPNMVAGTVGALVSPGGAGKSMLALQL-----------------AAQIA
1vhhA           ----------------------------------------------------------------------
1w1wA           ---------------------------------------------------------------KDYSIFL
1ak2A1          ----------------------------------------------------------------------
1lw7A2          --------------------------------ILGGESSGKSVLVNKLAAVFNTTSAWEYGREFVFEKLG
1iqrA2          ----------------------------------------------------------------------
1ckvA           -----MGLKGKDFADQFFADENQVVHESDTVVLVLKKSDEINTFIEEILLTDYKKNVNPTVNVEDRAGKI
2gujA1          ------------------------------------VKKGSDPYFTLQAVLDDQSSGRERVTLYDVNF-D
1jqjA3          -LEAGCDLLKQAFANEKFRGVRLYVSENQLKITANNPEQEEA-----------EEILDVTYSGAEME--I
1b77A2          -----------------VASVITEIKAEDLQQLLRVSRGLQIDTIAIT-----NKDGKIVINGYNK----
1e3mA2          -IRITEGRHPVVLNEPFIANPLNLSPQRRXLIITGPNXGGKSTYXRQTALIALXAYIGSYVPAQKVEIGP
1sbxA           ----------------------------------------------------------------------
1oa8A           ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------
1v37A           ----------------------------------------------------------------------
1g8fA3          ------------------------PKQGFSIVLGNSLTVSREQLSIALLSTFLQFGGGRYYKIFEHNNKT
1q3tA           -------------------------------AIDGPASSGKSKIIAKDFGFTYLDTGAMYRAATYMALKN
1yj5A2          ----------------------------------------------------------------------
1tueA           -LRYQQIEFITF--LGALKSFLKGTPKKNCLVFCGPANTGKSYFGMSFIHFIQGAVISFV---NSTSHFW
2vnuD1          RIRTRRAAELLD-KRIVISIDSWPTPLGHFVRDLGTIESAQAETEALLLEHDVEYR--------------
1esmA           LSRLLNFYISSNLRRQEQFLGTNGQRIPYIISIAGSVAVGKSTTAR-----------------------V
1a4iA2          ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1ckeA           -------------------------------TIDGPSGAGKGTLCKAM------AEALQWHLLDSGAIYR
2je6I3          -------------------GIVIDIMPVKVPRVIGKNKSMYE--TLTSKSIFVANNGRIWAFSEEILIEA
2bsqE1          ----------------------------------------------------------------------
1xkpA1          ----------------------------------------------------------------------
1yr6A1          -------------------------------VFVGTAGSGKTTLTGEFGRYLEDNYKVAYVNLDT----G
1pgsA2          ---IDGVPYGKAHTLKKNIQLPNTEKAYLRTTISGWGHAKPYDAGSRGCAEWCFRTHTIAINNANT----


                         .         .         *         .         .         .         .:140
query           KDEVSALRQRIGIVLQDFRLLDHMTTYENVALPFRVSGRDESSYRKEVIDLLKWVGLGERMDALPPVLSG
1sgwA           -----KVKGKIFFLPEEIIVPRKISVEDYLKAVASLYGVK---VNKNEIMDALESVEVLDLKKKLGELSQ
1b0uA           DKDGQLKVTRLTMVFQHFNLWSHMTVLENVMEAPQVLGLSKHDARERALKYLAKVGIDERAQGKYPVLSG
1ji0A           AHVIN--RXGIALVPEGRRIFPELTVYENLXXGAYNRKDKEGIKRDLEWIFSLFPRLKERLKQLGGTLSG
1mukA           -PMLQSTRKYFAQTLFMAKTVSGLNAIDSALLRLRTLGAD----KKALTAQLLMVGLQESEDALAGKIML
1e69A           PAGSAYVELVFEENGEEITVQIDRIVNAYQRVNESFNRFISLLFFGGEGRLEISIRKPGRRDQKLSLLSG
1ex6A           E------VNGKDYNFVSVDEFKSMIKNNEFIEWAQFSGNYYGSTVASVKQVSKSGKTCILDIDMQGVKSV
1pf4A1          LTN---LRRHFALVSQNVHLANNIAYAAEGEYTREQIEQAARQAHAMEFIENMPQGLDTVIGENGTSLSG
1l7vC           ATK---LALHRAYLSQQQTPPFATPVWHYLTLHQHDKTRTE-----LLNDVAGALALDDKLGRSTNQLSG
1e9rA           --MLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWASYGRLLLRETAKK
1q3hA           CSQFSWIMPGTIKENIIFGVSYDEYRYK----------SVVKACQLQQDITKFAEQDNTVLGEGGVTLSG
1m3eA1          LGLLLQSKQIISSYVGENAEFERQYLAGELEVELTPQGTLAERIRAGVPAFYTSTGYGTLVQEGGSPIKY
1ohcA1          ILYSR-PKSASNVHYFSIDELEYENFYADFGPLNLAMVYRY---CCKINKKLKSITM--LRKKIVHFTGS
2yyeA2          RNLMLSDATACTDVTGFGGHAWNICKNSNIGARIFFEKVPYYQLSENLVKKYPKGAIENLNFVKNYLKSN
1qhlA           SM-LDTINSRVGVRLQQAGRDRKVDIKPFAIQGLPMSVQPTQLVTETLNERQARVLPLNELKDKLEAMTD
1urjA           PFNANHRSIGEKFTYPLPFFNRFEAVVGPAAVALRSRNVDRAAAHLAFDENHEGAALPADITFTAFAGGF
1khbA1          QGH----LRAINPENGFFGVAPGTSVKTNPNAIKTIQKFTNVAETSDGGVYWEGIDEPLASGVTITSWKN
1bgxT2          PKGRVLLVDGHHLAYRTFHALKGLTTSRGEPVQAVYGFKALKEDGDAVIVVFDAKAPSFRHEAYGGYKAG
1nijA1          DQL---IGDRATQIKTLTNGCICCSRSNELALLDLLDNLDK------GNIQFDRLVIECTGMADPGPIIQ
2gx8A1          SLQRKVIKAMVTAHPYEEVAYDVYPLDNKGETLGLGKIGY---LQEEMTLGQFAEHVKQSLDVKGARVVG
2gk3A1          ----------LKVLFIGES----WHIHXIHSKGYDSFTSKYEEGATWLLECLRKGGVDTVQIAFPESIDE
1s9hA           -PFNDCVDKMVIWWEEGKMTAKVVESAKAILGGSKVRVDQKCKSSAQ----IDPTPVIVTSNTNMCAVID
1tljA           KNSTIIFKNHLRITEQDLEDVLSKNQVRRLWLIVQGPIIHIYAKNIETG--WDILKIAREAGFKHSGILA
2f9hA1          QATVTEIGKHAIDDSEKXIILFGETATDTLKQHAVIQSFPEKDQVTLAEGDHLKIGDTNYTITKVGSFAN
1mjgM           GS-----KLPLGILVDIYGRKMQADFEGVLERRIHDFINYGEGLWHTGQR--NINWLRVSKDAVAKGFRF
1mm8A           --RAADWAKS---VFSSAALGDPRRTARLVNYSGKSITISSEGSKAAQEGAYRFIRNPNVSA--EAIRKA
1f46A           -----NSIQQAGFIFGDMNIYHRHLSPDGSGPALFSLANMVKPGTFDPEMFTTPGVTIFMQVPSYGDELQ
1f2t.1          --------------------LSKIGELASEIFAEFTEGKYSEVVVRAEENKVRLFVVWEGKERPLTFLSG
1bccF           RWLEGIRKWYYNAAGNKYGLMRDDTIYENDDVKEAIRRLPENLYDDRMFRIKRALDLNMRQQILP---KE
1n25A           GVAIDQFLVGTGGESRDLPSGQGINNLDNLYLDGSVKVNLEKKHLNKRTQIFPPGIVTMNEYSVPKTLQA
1t06A           EELYATGNYDAMYFAGII-ADPKAMSESDFDRWIDGAYFYMLSDYVVAVTLSESNIAQDVADKWIA-SGD
1zs3A1          IDEKYAKELDKAEIDHHKPTAGAMLGHSNLFIENIRLTQAGIYAKSPVKYLREIAQREVEYFFKISDLLL
1bmfA3          AIGRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQAV
1pv4A3          EEVTEXQRLVKGEVVA-------STFDEPASRHVQVAEXVIEKAKRLVEHKKDVIILLDSI------TRL
1j1zA2          -------SMDANLLHISYEGGVLEDPWAEPPK----GMFRMTQDPEEAPDAPEYVEVEFF-EGDPVAVNG
1c4oA1          ----------AQLAAEFRELFPENAVEYFISYYDYYQPEAY--VPGKDLYIEKDASINPEIERLVVASVS
1zp6A1          GRIDPWLPQSHQQNRXIXQIAADVAGRYAKEGYFVILDGVVRPDWLPAFTALARPLHYIVLRTTAAEAIE
1es6A2          -------------------LRPGISFHPKLRPILNSADLTSPEKIQAIMTSLQDFKIVPIDPTKN--IMG
2qgmA1          ------------------------------------------SGQSVQKNIVK--SIQSQANPLKTIEPS
1jbkA           MGALVAGAKYRGEFEERLKGVLNDLAKQEGNVILFIDELHTMVGAMDAGNMLKPALARGELHCVGATTLD
1rkbA           EQLYDGYDEEYDCPILDEDRVVDELDNQMREGGVIVDYPERWFHIVFVLRTDTNVLYERLETRGYNEKKL
1i1qA           --------GAVGYFTAHGDLDTCIVIRSALVENGIATVQAGAGIVLDSVPQSEADETRNK--------AR
2vgmA3          --------------------------------------------------------------NKDDDKAW
1l3aA           ------SPEFSPLDSGAFKLSREGMVMLQFAPAAGVRQYDWSRKSLSVTEIGSIISLGKDSCEFFHDPNK
1jjvA           KDSPL--LSKIVEHFGAQILNRAALRERVF-------------NHDEDKLWLNNLLHPAIRERMKQKLAE
1t3wA           -------ENKLPGLGLFRELVNTCLSQPGLTTGQLLEHYRGT-NNAATLEKLSXWDDIADKNIAE--QTF
1jalA1          LDA---LAEIVKPERILPTTMEFVDIAGLVAGASKGEGLGNKFLANIRETDAIGHVVRCFENIDPLDDID
1xbtA1          RALPACLLRDVAQEALGVAVIGIDEGQFFPDIVEF---------CEAMANAGKTVIVAALDGTFQRKPFG
1ffhA2          ARE---QLRLLGEKVGVPVLEVMD-----------------GESPESIRRRVEEKARLEARDLILVDTAG
2fggA1          --------------------------------------------VGKTCQIDVLIEEHDERTRAKARLSW
3cddA1          ------------------------------------SKTKAGVSLILGDNVKAARGRFSWRQRFSKFTIK
2iqhA1          --MVMELIRMIKRGINRRTRIAYERMCNILKGKFQTAAQRTMVDQVRESRNPGNAEFEIFLARSALILRG
2v3jA1          PDITH--QCLLTLLDSPINKAGKLQVYIQTSRGILIEVNPTVRIPRTFKRFSGLXVQLLHKLSIRSEEKL
1e6cA           VADVVAAEGWPGFRRRESEALQAVATPNRVVATGGGMVLLEQNRQFMRAHGTVVYLRLQASLQAHQRPTL
1g6hA           KEPAELYHYGIVRTFQTPQPLKEMTVLENLLIGEICPGESPEEMVEKAFKILEFLKLSHLYDRKAGELSG
1viaA           VSEIFEQKRENFFREQEQKXADFFSSCEKACIATGGGFVFCIYLKADFEYLKKRLDKDEISKRPLFYDEI
1bs2A1          --------------------------------------------------------TGPYLQYAHSRLRS
1d6jA           -------DNIRFGLNKDLGFSEADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVATP
1dhyA1          --------------------------------------------GYLGFAVKDVPAWDHFLTKSVGLMAA
1gm5A1          -----------------SSLFLWGEALPTLLEEFLNEVEKMLKNQVNTRRIHQLLKELDDPLLENKDLEE
2axpA1          KLFEHFNKLADEDNVIIDRFVYSNLVYAKKFKDYSILTERQLRFIEDYLHADPSVIKKRLRVRGDEYIEG
1cd5A           KIHLFMGGVGNDGHIAFNEPASSLASRTRIKTLTHDTRVANSRFFDNDVNQVPKYALTVGVGTLQAAVEG
1poiA           GNGRVK-AYINCYTANSGVTNVSRRFRKWFEAG-KLTMEDYS--QDVIYMMWHAAALGLPFLPVTLMSKE
1f8xA           ----------------------------------------------------------KTIYFGAGWFTD
1udwA           EQKAKALKGQFNFDHPDAFDNELILKTLKEITEGKTVQIPVYDFVSHSRKEETVTV------------YP
1kgdA           EENGKNYYFVSHDQMMQDISNNEYLEYG----------SHEDAMYGTKLETIRKIHEQGLIAILEPQALK
2pa7A1          ----------------------------------------------------------KKLEQVLVCLNG
1ii8.1          -------KVKKYKALAREAALSKIGELASEIFAEFTEGKYSEVVVRAEENKVRLFVVWEGKERPLTFIAL
1t9hA2          -------EEELGYTFPDIREKSSSCKFRGCLHL------KEP--KCAVKQAVEDGELKQYRYDHYVEFMT
1o7d.2          ------------------------------------------------------------------VYNP
1qhdA1          --DLITNYSPSREDNLQ-RVFTVASIRSML----------------------------------------
1jb1A           IV------GAAPPILSHLLEIRGLGIIDVXNLFGAGAVREDTTIVHLENWTPDQLIFDVPVPKITVPVKV
1mi8A           -KRLDELSLKEHIALPRKSDSWDSIVSITETGVEEVFDLTVPGPHNFVANDI------------------
1atrA1          AKNQVAMNPTNTVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSMKEIAEAYLGKTVTNAVVTVPAYFND
1puoA2          FYDVFFAVANGNELLLDLSLTVNATEPERTAMKKIQDCYVENGLISRVLDGLVMTTISSSKD--------
1grqA           --LKMQSAEGGIEFDADGGV--SIGPEFRALEGAWAEGVVAMARAGARIIIDDVFLGGAAAQERWRSFVG
1xl3C1          ----------------------SEFMGDIVALVDGIHDIEHLANAFSLPTVRFYQDLXRMFRLFPLGVFS
1ovmA2          ----QQRGELLHHTLGDGEFRHFYHMSEPITVAQAVLTEQNACYERVLTTMLRERRPGYKKAATPPV---
1d8jA           ---------------------------------LSGSSGYKFGVLAKIVNYMKTRHQLDEILDETQHLDI
1afrA           EQVRELASPTSWAIWTRAWTAEENRHGDLLNKYLYLSGRVDMRQIEKTIQYLIGSG-MDPRTENSPYLGF
1g6oA           -EIVFKHHKNYTQLFFGGNITSADCLKSCLRPDRIILGELRSSEAYDFYNVLCSGHK-GTLTTLHAGSSE
1dnpA2          -----------------VWFRQDLRLHDNLAL-----------AAACRNSSARVLALYIATPRQWATHNM
1l7lA           DQGLICHDAFCGALVMKI----GNSGTIPVNTGLFRWVAPNNVQGATLIYNDVPGTYGNNSGSFSVNIGK
1cr0A           EESVEETAEDLIGLHNRVRLRQSDSLKREII---------ENGKFDQWFDELFGNDTFHLYDS-FAEAET
1v47A1          ----------------------------------------------------------------------
2gtlM1          DHADCKIVPSSLFVCAHFNAQRY-----------------------------------------------
1vplA           VEEPHEVRKLISYLPEEAGAYRNMQGIEYLRFVAGFYASSSSEIEEMVERATEIAGLGEKIKDRVSTYSK
1fl9A           TLVEEYNIAGKMIYHFDLYRLADPEELEFMGIYFNTDSICLIEWSEKGQGILPLVNIDYYDDARNIELIA
1ni3A1          VAVPDERFDWLCEAYKPKSRVPAFLTVFDIAGL----TKGASTGVGLGNAFLSHVRAVDAIYQVVRAFDD
3cddA2          VPSYDESTITISVSGRDKTADLVDCSIDYPSGQFNNQTLTQIADIVCKPFGIKVIVNTDVGEPFQRIQIE
1np6A           --------------------------------------------------------------------KH
1em8A           ----------------------------------------------------------------------
1yvuA2          YDFVKRELLKKXIPSQVI-LNRTKFVLLNVAEQVKTGNIPYKLKEIEGKVDAF---VGIDISRI----TR
1g8yA           GGPDLLEVGELPTGPVIYLPAEDPPTAIHHRLHALGAHLSAEERQAVADGLLIQPLIGSLPNIMAPEWFD
1vhhA           --------------------------------------------YKQFIPNVAEKTLGASGRYEGKITRN
1w1wA           ENENILIKAKNFLVFQ--GDVEQIAAQSPVELSRMFTFDYVSDHLDAIYRELTGNASLTKYHATPPLLSG
1ak2A1          ----------------------------------------------------------------DSVIEF
1lw7A2          GDE---QAMQYSDYPQXALGHQRYIDYA-----------------VRHSHKIAFIDTDFITTQAFCIQYE
1iqrA2          -------------------------------------GDLRLHDHPALLEALARGPVVGLVVLDPNNLKT
1ckvA           EVDCDEISELLGRQFNVYDFLVDVS---------------------------------------------
2gujA1          SAKIASLDEEVPFTFEDFDVPEKL----------------------------------------------
1jqjA3          GFNVSYVLDVLNALKCENVRM-MLTDSVSSVQI-------------------------------------
1b77A2          VEDSGLTRPKYSLTLTDYDGSNFVINMANMKIQPGNYKVMLWGAGDKVAAKFESSQVSYVIAMEAD----
1e3mA2          IDRIFTRVGFXVEXTETANILHNATEYSLVLXDEIGRGTSTYDGLSLAWAC--AENLANKIKALTLFATH
1sbxA           -------------------------------------------------------------------RST
1oa8A           ---------------------------EDLKTEDFIQSAEISNDLKIDSSTVERIEDSHSPGVAVIQFAV
1iioA           -----------------------------------------------------PNGPDTTCKSGDVELKA
1v37A           -----------------------------------------SSDLLRARRTAELAGFSPRLYPELREIHF
1g8fA3          ELLSLIDFIGSGSGLIIPDQVYLLDTSSSADIQLESADEPISHIVQKVVLFLEDNGFFV-----------
1q3tA           QLGVEALLDQHPISFGRSETGDQLVFVGDVDITHPIRENEVTNHVSAIAAIP---EVREKLVSLQQEI-A
1yj5A2          ----------------------------------------------------------------------
1tueA           LEPLTDTKVAMLDDATTTCWTYFDTYMRNALDGNPISIDPLIQLKCPPI---------------------
2vnuD1          ----------------------------------------------------------------------
1esmA           LQALLSRWPEHRRVELITTDGFLHPNQVLKERGLXKKKGFPESYDXHRLVKFVSDLKSGVPNVTAPVYSH
1a4iA2          ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1ckeA           VLALAALHHHVDVA--SEDALVPLASHLDVRFVSTNGNLEVILEGEDVSGEIRTQE-VANAASQVAAFPR
2je6I3          IRK---IENESHI---------------------------------------------------------
2bsqE1          --------------------VVIRNLSEATHNAIKFRARTEAEIRLILDNIAKAQRLGSMLASIGQEIGG
1xkpA1          ----------------------------------------------------------------------
1yr6A1          VKELPYEPSIDVREFVTVEEIMREGYGPNGAIVESYDRLMEKFNEYLNKILRLEKENDYVLIDTPG----
1pgsA2          -FQHQLGALGCSANPINNQSPG-NWTPDRAGW--------------------------------------


                         +         .         .         .         .         *         .:210
query           GEKQRAAIARAVIGRPQLLLADEPTGNVDPTLGRRLLRLFVELNKSGTAVVIATHDINLMDQYEARRMVL
1sgwA           GTIRRVQLASTLLVNAEIYVLDDPVVAIDEDSKHKVLKSILEILKKGIVIISSREELSYCD----VNENL
1b0uA           GQQQRVSIARALAMEPDVLLFDEPTSALDPELVGEVLRIMQQLAEEGKTMVVVTHEMGFARHVSSHVIFL
1ji0A           GEQQXLAIGRALXSRPKLLXXDEPSLGLAPILVSEVFEVIQKINQEGTTILLVEQNALGALKVAHYGYVL
1mukA           QDVNTVQLARVVNLAVPDTWMSLDFDSMFKHHVKLLPKDGRHLNDIPPRMGWLRAILRFLGA--------
1e69A           GEKALVGLALLFAKPSPFYVLDEVDSPLDDYNAERFKRLLKENSKHTQFIVI-THNKIVMEAADLHGVTM
1ex6A           KAIPELNARFLFIAPPSVEDLKKRLEGRGTETEESINKRLSAAQAGAHDKVIVNDDLDKAYKELKDFIFA
1pf4A1          GQRQRVAIARALLRDAPVLILDEATSALDTESERAIQAALDELQKNKTVLVI-AHRLSTIEQAD-EILVV
1l7vC           GEWQRVRLAAVVLQIGQLLLLDEPXNSLDVAQQSALDKILSALCQQGLAIVXSSHDLNHTLRHAHRAWLL
1e9rA           LALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASALTSARFVLSDKLPEHVTMPDGDFSI
1q3hA           GQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANK-TRILVTSKMEHLRKADKILIL
1m3eA1          NKDGSIAIASKPREVREFNGQHFILEEAIRGDFALVKAWKADQ-AGNVTFRKSARNFN------------
1ohcA1          DQRKQANAAFLVGCYMVIYLGRTPEEAYRILIFGEPFRDAAYGSCNYITLLDCFHAVKKAMQY-------
2yyeA2          LDNWKLILLSDPVTSGGLLFTINKEK------LEKIDETAKELEVNYWIIGETIAE--------------
1qhlA           YHSLMFDLLRSASDRSKFYRLIEASGGISSAITRSLRDYLLP----------------------------
1urjA           EQRLASVMAGDAAIVSMAVFDEPPTDIEGQDTAAARANAVGAYLARAAGLVGAMVFS--TNSALHLTEVD
1khbA1          KEWSSEDGEPCAHPNSRFCTPASQCPIIDAAWESPEGVPIEGIIFGGRRPAGVPLVYEALSWQ--HGVFV
1bgxT2          RAPTPEDFPRQLALIKELVDLGLARLEVPGYEADDVLASLAKKAEKGYEVRILTADKDLYQLLSDRIHVL
1nijA1          TFFSHEVLCQRYLLDGVIALVDAVHADEQMNQFTIAQSQV---GYADRILLTKTDVAGEAEKLHERLARI
2gx8A1          KLDDKVRKVAVLGGDGNKYINQAKFKGADVYVTGDMYYHVAHDAMLGLNIVDPGHNVEMKQGVQKQLQEK
2gk3A1          LNRYDVIVISDIGSNTFLLQNETFYQLKIKPNALESIK---EYVKNGGGLLLSFXGIEAKANY----KNT
1s9hA           GNSTTFEHQQPLQDRMFKFELTRRLDHDFGKVTKQEVKDFFRWAKDHVVEVEHEFYVK------------
1tljA           TNQKGVLVELRTGIRMVHLLRESNTERVDKDKIKTLVNVCNEVLARGKQKMNLLKD--------------
2f9hA1          SNLQSIAHSTLIFADAPTDEDDVIRNGVYLTPHQLPKI------TIGTTIDY------------------
1mjgM           KNYGEILVAKMKEEFPAIVDRVQVTIFTDEAKVKEYMEVAREKYKDDRMRGLTDETVDTF---YSCVLCQ
1mm8A           GAMQTVKLAQ----EFPELLAIEDTTSLSYR--HQVAEELGKLGSIDKSRGWWVHSVLLLEATTFRTVGL
1f46A           LFKLMLQSAQHIADEVGGVVLDDQRRMMTPQKLREYQDIIREVKDAN-----------------------
1f2t.1          GERIRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKKIPQVILVSHDEELKD---------
1bccF           QWTKYEEDVPYLEPYLKEVI--------------------------------------------------
1n25A           RFVKQIDFRPKDYLKHCLERSEFLLEKRIIQSGIALLMLIWYRPVAEFAQSIQSRIVEWKERLDKEFSLS
1t06A           ELKMSAGWSWLLGNRKDNAFSESKISDMLEMVKDTIHHPERTKSAMNNFLNTVAPLHEKAVEIAKEVGIV
1zs3A1          DENEIVPSTTEEFLKYHKFITEDPKAKYWTD-EDLLESFIVDFQAQNMFI---TRAIKLANKLAAGVVEL
1bmfA3          AYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDAFGGGSLTALPVIETQAG-DVSAYIPTNVISI
1pv4A3          ARAYNTVVPAVLTGGVDANALHRPKRFFGAARNVEEGGSL-----TIIATALIDTGSKXDEVIYEEFKGT
1j1zA2          ERLSPAALLQ----RLNEIGGRHGVGRVDIVENRFVGMKSRGVYETPGTILYHARRAVESLTLDREVLHQ
1c4oA1          AIYGLGDPREYRARNLVGFVLFPATHYLSP----------------------------------------
1zp6A1          RCLDR--GGDSLSDPLVVADLHSQFADLGAFEHHVLPVSGKDTDQALQSAINALQS--------------
1es6A2          IEVPETLVLKLTGGQPIIPVLLPKYIGLDPVAPGDLTMVITQDCDTCHSPAS------------------
2qgmA1          KPFEDLKPLKKXIGNAQYVGLGENTHGSSEIFTXKFRLVKYLVTEXGFTNFAXEEDWGNGLKLNEYIQTG
1jbkA           EYRQYIEKDAALERRFQKVFVAEPSVEDTI----------------------------------------
1rkbA           TDNIQCEIFQVLYEEATASYKEEIVHQLPSNKPEELENNVDQI---------------------------
1i1qA           AVLRAIATAH------------------------------------------------------------
2vgmA3          YGEKEVVKAAEYGAISYLLLTDKVLHSDNIAQREEYLKLMDSVESNGGKALVLSTLHSLGEELDQLTGIA
1l3aA           GRSDEGRVRKVLKVEPLP---DGSGHFFNLSVQNKLINLDENITKAEFAVLVSAFN---------FVMPY
1jjvA           QTAPYTLFVVPLLIENKLTALCDRILVVDVSPQTQLARSAN--FEQIQRIMNSQVSQQERLKWADDVINN
1t3wA           TDSLNHXFDSLLELRQEELIARERTHGLSNEERLELWTLNQELAK-------------------------
1jalA1          TINTELALADLDSCERAIQRLQKRAKGGDKEAKFELSVMEKILPVLENAGMIRSVGLDKEELQAIKSYNF
1xbtA1          AILNLVPLAESVVKL-------------------------------------------------------
1ffhA2          RLQIDEPLMGELARLKEVLGPDEVLLVLDAMTGQEALSVARAFDEKGVTGLVLTKLDGDARGGAALSRHV
2fggA1          AGRQXVGVGLAR-----LDPADEPVAQIGD-----ELAIARALSDLANQLFALTSSDIEASTH-------
3cddA1          AAKADVTDSEIGRYRPLIIVNEEVTAEGAAKRGQWERQRSIGKSNXAEYTVTGWRIPQTGKLWNNTLVPV
2iqhA1          SVAHKSCLPACVYGSAVASGYDFEREGYSLV------GIDPFRLLQNSQVYSLIRPNENPAHKSQLVWMA
2v3jA1          LKVIKNPITDHLPTKCRKVTLSFDAPVIRVQDYIEKLDDD--ESICVFVGAXARGKDNFADEYVDEKVGL
1e6cA           TGRPIAEEMEAVLREREALYQDVAHYVVDATIVCELMQT-------------------------------
1g6hA           GQMKLVEIGRALMTNPKMIVMDEPIAGVAPGLAHDIFNHVLELKAKGITFLIIEHRLDIVLNYIDHLYVM
1viaA           KAKKLYNERLSKYEQKANFILNIENKNIDELL-SEIKKV-------------------------------
1bs2A1          VERNASGITQEKWINADFSLLKEPAAKLLIRLLGQYPDVLRNAIKTHEPTTVVTYL---FKLTHQVSSCY
1d6jA           GEETGLPFVEVYVDVPVEAPYEAPANKNYELPVQDAVKQIIDYLDT-KGYLPA-----------------
1dhyA1          GSAGDAALYRADQRAWRIAVQPGELDDLAYAGLEVDDAAERMADKLRQAGVAFTRGDEAL--MQQRKVMG
1gm5A1          KLQAFLDYVKEIPN------LPEARKRYRIQKSLEMIEKLRSWFLID-----------------------
2axpA1          KDDSILELYREVXSNAGLHTYSWDTGQWSSEIAKDIIFL-------------------------------
1cd5A           CVNHMWTISCLQLHPKAIMVCDEPSTMELKVKTLRYFNELEAENIKG-----------------------
1poiA           VRKTLDKVPDDKFKYIDPFKPGEKVVAVPPQVDVAIIHAQ-QASPDGTVRIWGGKFQDVDIAEAAKY---
1f8xA           RQNKAYKEAMEALKENPTIDLENSYVPLDNQYKGIRVDEHPEYLHDKVWATATYNNDLNGIKTNDIMLGV
1udwA           ADVVLFEGILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCL
1kgdA           VLRTAEFAPFVVFIAAPTITPGLNEDESLQRL-QKESDILQRTYAHYFDLTIINNEIDETIRH-LEE-AV
2pa7A1          SCRVILDDGNI----IQEITLDSPAVGLYVG--PAVWHEMHDFSSDCVMMVLASDYYDETDYIRQYDNFK
1ii8.1          GLAFRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKKIPQVILVSHDEELKDAAD-HVIRI
1t9hA2          EIKDR-----------------------------------------------------------------
1o7d.2          LGRKVDWMVRLPVSKHVYLVKDPGGKIVPSDVVTIPSSDSQELLFSALVPAV-GFSIYSVSQMP-RDLVI
1qhdA1          ----------------------------------------------------------------------
1jb1A           GRNLAIIIEVAAXNFRAKSXGYDATKTFEKNLNHLI----------------------------------
1mi8A           ----------------------------------------------------------------------
1atrA1          SQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDK-----------------------------------
1puoA2          ----------------------------------------------------------------------
1grqA           DLDVLWVGV-----RCDGAVAEGRETARGDRVAGMAAKQAYVVHEGEYDVEVDTTHKESIE---------
1xl3C1          DEEQRQNLLQMCQNAIDMAIESE-----------------------------------------------
1ovmA2          ----------------------------------------------------------------------
1d8jA           GLKQKQWLMEALVNNPKIEVIDGKYAFKPK----------------------------------------
1afrA           IYTSFQERATFISHGNTARQAKEHGDIKLAQICGTIAADE------KRHETAYTKIVEKLFEIDPDGTVL
1g6oA           EAFIRLASNSAARNIKFESLIEGFKDLIDXIVHINHHKQ-------------------------------
1dnpA2          SPRQAELINAQNGLQIALAEKGIPLLFREVDDFVASVEIVKQCAENSVTHLFYNYQYEVNERARDVEVER
1l7lA           DQ--------------------------------------------------------------------
1cr0A           DRLLAKLAYMRSGLGCDVIILDHIS---IRKMIDNLMTKLKGFAKTGVVLVVICHDLRALRQLSDTIIAL
1v47A1          ---PALEIGEDERLDLENLA-TGAFFPVKGFMTREEALSVAHEMRLPTGEVWTIPILLQFREKPRVGPLL
2gtlM1          ----------------------------------------------------------------------
1vplA           GMVRKLLIARALMVNPRLAILDEPTSGLDVLNAREVRKILKQASQEGLTILVSSHNMLEVEFLCDRIALI
1fl9A           QTNLGKNIISA-----------------------------------------------------------
1ni3A1          AEIIHVEGDVDPI--RDLSIIVDELLIKDAEFVEKHLEGLRKITSRG-----------------------
3cddA2          QGETPHELLARLAKQRGVLLTSDTFGNLVIT---------------------------------------
1np6A           EEIAKIVLFRDGAGHRPEELVIDRHVIAVADVPLNLDVALLDINDVGLADFVVEWM--------------
1em8A           ------------MKNATFYLLDNDTTVDGLSAVEQLVCEIAAEWRSGKRVLIACEDEKQAYRLDEALWAR
1yvuA2          DGKTVNAVAFTKIFNSKGELVRYYLTSYPAFGEKLTEKAIGDV-------FSLKLGFKKGS----KIVVH
1g8yA           GLKRAAEGRRLMVLDTLRRFHIEEENASGPM-AQVIGRMEAIAADTGCSIVFLHHAVLVDNIRWQSYSSM
1vhhA           SERFKELTPNY---NPDIIFKDEENTGADRRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLH
1w1wA           GEKTVAALALLFYQPSPFFVLDEVDAALDITNVQRIAAYIRRHRNPDLQFIVISLKNTMFE---------
1ak2A1          SIPDSLLIRRITGRLIHSDDNKKALKIRLEAYHTQTTPLVEYYSKRGIHSAIASQTPD-----VVFASIL
1lw7A2          GKAHPFLDSXIKEYPFDVTILLKNN---------------------------------------------
1iqrA2          TPRRRAWFLENVR------ALREAYRARGGALWVLEGLPWEKARRLKAKAVYALTSHTPYGRY-RDGRV-
1ckvA           ----------------------------------------------------------------------
2gujA1          ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
1b77A2          ----------------------------------------------------------------------
1e3mA2          YFELTQLPEKXEGVANVHLDALEHGDTI-----AFXHSVQDGAASKSYGLAVA-ALAGVPKEVRARQ---
1sbxA           ERCETETISCFVVGGEKRL---CLPQILNSVLRDFSLQQINAVCDLHIYCSRCTADQLEILKVXGILPFS
1oa8A           GEHRAQVSVEVLVEYP-FFVFGQGWSSCCPERTSQLFDLPCSKLSVGDVCISLTL---------------
1iioA           SDAGQVLTADDPFKSAEEVADTIVN---------------------------------------------
1v37A           GALEGALWETLDPRYKEALLRFQGFHPPGGESLSAFQERVFRLEGLKAPAVLFTHG--------------
1g8fA3          ----------------------------------------------------------------------
1q3tA           QQGGIVMDGRD-IGTVVLPQA-ELKIFLVASVDERAERRYKENIAKGIETDLEKKEIAARDYKDSHR---
1yj5A2          ------QFEPPTLAEGFLEILEIPFRLQEH-LDPALQRLYRQFS--------------------------
1tueA           ----------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
1esmA           LIYDVIPDGDKTVVQPDILILEGLNVLQSGXDYPHDPHHVFVSDFVDFSIYVDAPEDLLQTWYINRFLKF
1a4iA2          ---------------PAEILNGKEI---SAQIRARLKNQVTQLKEVPGFTPRLAILQVGNRDDSNLYINV
1g31A           --------LPIRAVGEYVILVSEPAQAGDEEVTESGLIIGKRVQ----GEVPELCVVHSVGPDVPEGCEV
1ckeA           VREALLRRQRAFRELPGLIADGRDMGFLDASSEERAHRRMLQLQVKGFSVNFELAEIKLVPAADALVLDS
2je6I3          ----------------------------------------------------------------------
2bsqE1          VELED-----------------------------------------------------------------
1xkpA1          ------QFXMLCGLRDALXGRPEL-----AHLSHLVEQALVSMAEQGETIVLGARITPEAYRESQSGVNP
1yr6A1          ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           HQGRLHIYE
1sgwA           HKY------
1b0uA           HQGKI----
1ji0A           ETGQI----
1mukA           ---------
1e69A           VNGVSAIVP
1ex6A           EK-------
1pf4A1          DEGEI----
1l7vC           KGGK-----
1e9rA           RSWLEDPN-
1q3hA           HQGSS----
1m3eA1          ---------
1ohcA1          ---------
2yyeA2          ---------
1qhlA           ---------
1urjA           DAGPAHSKP
1khbA1          GAAM-----
1bgxT2          HPEGY----
1nijA1          NARAPVYT-
2gx8A1          VDAKK----
2gk3A1          VLAEVL---
1s9hA           ---------
1tljA           ---------
2f9hA1          ---------
1mjgM           SFAPNHVC-
1mm8A           LHQE-----
1f46A           ---------
1f2t.1          ---------
1bccF           ---------
1n25A           VYQKM----
1t06A           EVKR-----
1zs3A1          YGY------
1bmfA3          TDGQI----
1pv4A3          GNXELH---
1j1zA2          RDMLSPKY-
1c4oA1          ---------
1zp6A1          ---------
1es6A2          ---------
2qgmA1          KGNPREFL-
1jbkA           ---------
1rkbA           ---------
1i1qA           ---------
2vgmA3          CILKYPLPD
1l3aA           LLGW-----
1jjvA           DAELA----
1t3wA           ---------
1jalA1          LTLKPTMYI
1xbtA1          ---------
1ffhA2          TGKPI----
2fggA1          ---------
3cddA1          IDEIXGLD-
2iqhA1          CHSAAFED-
2v3jA1          SNYPL----
1e6cA           ---------
1g6hA           FNGQI----
1viaA           ---------
1bs2A1          DVLWV----
1d6jA           ---------
1dhyA1          LLCL-----
1gm5A1          ---------
2axpA1          ---------
1cd5A           ---------
1poiA           ---------
1f8xA           YIPDE----
1udwA           PTKK-----
1kgdA           EL-------
2pa7A1          KYIAK----
1ii8.1          SLENG----
1t9hA2          ---------
1o7d.2          QNEYLRA--
1qhdA1          ---------
1jb1A           ---------
1mi8A           ---------
1atrA1          ---------
1puoA2          ---------
1grqA           ---------
1xl3C1          ---------
1ovmA2          ---------
1d8jA           ---------
1afrA           AFADM----
1g6oA           ---------
1dnpA2          ALRNVVCE-
1l7lA           ---------
1cr0A           ERNQLVLVR
1v47A1          HGGER----
2gtlM1          ---------
1vplA           HNGTI----
1fl9A           ---------
1ni3A1          ---------
3cddA2          ---------
1np6A           ---------
1em8A           PAES-----
1yvuA2          RDGRLYRDE
1g8yA           TSAEA----
1vhhA           YEGRA----
1w1wA           ---------
1ak2A1          A--------
1lw7A2          ---------
1iqrA2          ---------
1ckvA           ---------
2gujA1          ---------
1jqjA3          ---------
1b77A2          ---------
1e3mA2          ---------
1sbxA           PSCGL----
1oa8A           ---------
1iioA           ---------
1v37A           ---------
1g8fA3          ---------
1q3tA           ---------
1yj5A2          ---------
1tueA           ---------
2vnuD1          ---------
1esmA           REGAF----
1a4iA2          KLKAAE---
1g31A           GDLTS----
1ckeA           TTL------
2je6I3          ---------
2bsqE1          ---------
1xkpA1          LQPLRDTY-
1yr6A1          ---------
1pgsA2          ---------