[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for rpal2:ABE38253.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3c96A1.bssp"
#ERROR : Can't open dsspfile "1fohA5.bssp"
#ERROR : Can't open dsspfile "1vqwA1.bssp"
#ERROR : Can't open dsspfile "1bf3A1.bssp"
#ERROR : Can't open dsspfile "2vouA2.bssp"
#ERROR : Can't open dsspfile "1fohA3.bssp"
#ERROR : Can't open dsspfile "2vouA1.bssp"
#ERROR : Can't open dsspfile "2gqfA1.bssp"

## Summary of PDB Search
:540
    3e-22  14%  3c96A1 [c.3.1.2] FLAVIN-CONTAINING MONOOXYGENASE A:4 -- 182 A:294
    1e-19  20%  1fohA5 [c.3.1.2] PHENOL HYDROXYLASE A:1 -- 240 A:342 -- 461
    7e-15   8%  1vqwA1 [c.3.1.5] PROTEIN WITH SIMILARITY TO FLAVIN-CONTAINING A:3
    9e-12  18%  1bf3A1 [c.3.1.2] P-HYDROXYBENZOATE HYDROXYLASE A:1 -- 173 A:276 --
    1e-11  10%  2vouA2 [d.16.1.2] 2,6-DIHYDROXYPYRIDINE HYDROXYLASE A:164 -- 291
    7e-05  11%  1fohA3 [c.47.1.10] PHENOL HYDROXYLASE A:462 -- 662
    2e-04  16%  2vouA1 [c.3.1.2] 2,6-DIHYDROXYPYRIDINE HYDROXYLASE A:2 -- 163 A:292
    3e-04  20%  2gqfA1 [c.3.1.8] HYPOTHETICAL PROTEIN HI0933 A:1 -- 194 A:343 --
:540

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLSLAIDLAQRGENVVLLDDADRIGEGSRAICF
3c96A1          ----------------------------------------------------------------------
1fohA5          --------------------------------------LMAARVLSEYDLKVRIIDKRSTKVYNGQADGL
1vqwA1          --------------------------------------LVTAKALLAEKAFDQVFERRGSPGGVWNYTST
1bf3A1          ----------------------------------------------------------------------
2vouA2          ----------------------------------------------------------------------
1fohA3          ----------------------------------------------------------------------
2vouA1          ----------------------------------------------------------------------
2gqfA1          --------------------------------------LFCAAQLAKLGKSVTVFDNGKKIGRKSQNPHF


                         .         .         *         .         .         .         .:140
query           SKRALEVWDRLGVGARMVEKGVVWQVGKIFRRDEMVYQFDLLPETGHKMPAFINLQQYYAEAYLVERVQQ
3c96A1          ----------------------------------------------------------------------
1fohA5          QCRTLESLKNLGLADKILSEANDMSTIALYNPNGHIRRTDRIPDTGISRYHQVVLHQGRIERHILDSIAE
1vqwA1          LSNKLPVPSTNPILTTEPIVGPAALPVYPSPLYRDLQTNTPIELXGYCDQSFKPQTLQFPHRHTIQEYQR
1bf3A1          ----------------------------------------------------------------------
2vouA2          ----------------------------------------------------------------------
1fohA3          ----------------------------------------------------------------------
2vouA1          ----------------------------------------------------------------------
2gqfA1          VKSALARYTNWDFISLVAEQGITYHEKELGQ---------LFCDEGAE--QIVE--------XLKSECDK


                         +         .         .         .         .         *         .:210
query           LPQIDLRWRNKVTALAQHNDHAVLTIETPDGSYRLAADYVVACDGARSALRGMVGAEFAGEVFEDQFLIA
3c96A1          ------AGIGKVTLLESSSEIRPLGVGINIQAIPTHELRYIDQSG-ATVWSEPRGVEAGNAYPQYSIHRG
1fohA5          ISDTRIKV------------------ERPLIPEKMEIDSSKAEDPEAYPVTMTLRYMSDHE---------
1vqwA1          IYAQPLLPFIDIEKKDGSWVVTYKGTKAGSPISKDIFDAVSICNGHYEVPYTGYLYSVPFPSLAKLKSPE
1bf3A1          ----------------------------------------------------HEGVEIAFAGQRRRIDLK
2vouA2          --------------------------------------------------------TYAGYVTWRGPGEV
1fohA3          ----------------------------------------------------------------------
2vouA1          ----------------------------------------------------------------------
2gqfA1          Y-GAKILLRSEVSQVEQNDEKVRFVLQVNSTQWQ--CKNIVATGGLSXPGLG------------------


                         .         .         .         +         .         .         .:280
query           DVRMNAEFPTERWFWFDPPFHSGQSALLHRQPDNVWRIDLQIGADADAAVERLPENVRPRIERMLGNSDF
3c96A1          ELQMILLAAVRERLGQQAVRTGLGVERIEERDGR-VLIGARDGHGKPQALGADVLVGADGIHS-----AV
1fohA5          STPLQFGHKTENSLFHSNLQT-------QEEEDANYRLPEGKEAGEIETVHC--------KYVIGCDGGH
1vqwA1          TKLIDDGSHVHNVYQHIFYIPDPTLAFVGLALHVVPFPTSQAQAAFLARVWSGRLKLPSKEE-------Q
1bf3A1          RLSGGKTVTVYGQTEVTRDLMEAREASGATTVYQAAEVRLHDLQGERPYVTFERDGERLRLDCDY---IA
2vouA2          ADDVWNYFNDKFTYGLLDDGHLIAYPIPGRENAESPRLNFQWYWNVAEGLDELMTDVRGIRLPTSVHNNS
1fohA3          ----------------------------------------------------------------------
2vouA1          --------RKRLLGIETVDRMVHGRVLLIGDAAVTPRPHAAAGAKASDDARTLAEVFTKNHDLRG--SLQ
2gqfA1          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           SFEWISIYKFQCRRMQRFLHERVIFAGDSAHQVSPFGARGANSGLEDGENIAWKLAMVLRGDAPASLLDS
3c96A1          RAHLHPDQRPLRDPLPHWGRGRITLLGDAAHLMYPMGANGASQAILDGIELANKIILANREREKE-EWAA
1fohA5          SWVRRTLGFEMIVTEKFSKDERVFIAGDACHTHSPKAGQGMNTSMMDTYNLGWKLGLVLTGRAKRDILKT
1vqwA1          LKWQDELXFSLSGANNXYHSLDYPKDATYINKLHDWCKQATPVLEEEFPSPYWGEKERSIRENXWSIRAK
1bf3A1          GCDGFHGISRQSIPAERMQHGRLFLAGDAAHIVPPTGAKGLNLAASDVSTLYRLLL-KAYREGRGELLER
2vouA2          --LNPHNLRQFHSKGESLFKPFRDLVLNASSPFVTVVA--------------------------------
1fohA3          ----------------------------------------------------------------------
2vouA1          SWETRQLQQGHAYLNKVKKMASRLQHGGSFEPGNPAFAFGLPKVDEP-----------------------
2gqfA1          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           YEIERSQAADDNIRHSTRSTDFIAPHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3c96A1          ASRPE-----------------------------------------------------------------
1fohA5          YEEERHAFAQALIDFDHQFSRLFSGR--------------------------------------------
1vqwA1          FF--------------------------------------------------------------------
1bf3A1          YSAICLRRIWKAERFSWWMTSV------------------------------------------------
2vouA2          ----------------------------------------------------------------------
1fohA3          ----------------------------------------------------------------------
2vouA1          ----------------------------------------------------------------------
2gqfA1          ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxVFLTDAFKAAGCGFVLLEIANGAAAPAPQGVRSLRIGKDAPLRD
3c96A1          ----------------------------------------------------------------------
1fohA5          ----------------------------------------------------------------------
1vqwA1          ----------------------------------------------------------------------
1bf3A1          ----------------------------------------------------------------------
2vouA2          ----------------------------------------------------------------------
1fohA3          --------------------------RIDVITIHSCHRDDIEMHDFPAPALHPKWQYDFIYAD-CDSWHH
2vouA1          ----------------------------------------------------------------------
2gqfA1          ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           EEGLFTKRYDATPGAAYLLRPDGYVAARFRHPxxxxxxxxxxxxxxxxxx
3c96A1          --------------------------------------------------
1fohA5          --------------------------------------------------
1vqwA1          --------------------------------------------------
1bf3A1          --------------------------------------------------
2vouA2          --------------------------------------------------
1fohA3          PHPKSYQAWGVDEGAVVVVRPDGYTSLVTDLE------------------
2vouA1          --------------------------------------------------
2gqfA1          --------------------------------------------------