[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for rpal2:ABE38261.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1t3qB2.bssp"
#ERROR : Can't open dsspfile "1ffuB2.bssp"
#ERROR : Can't open dsspfile "1rm6A2.bssp"
#ERROR : Can't open dsspfile "1fiqC2.bssp"
#ERROR : Can't open dsspfile "1dgjA4.bssp"
#ERROR : Can't open dsspfile "1hi9A.bssp"
#ERROR : Can't open dsspfile "1ffuB1.bssp"
#ERROR : Can't open dsspfile "1fo4A3.bssp"
#ERROR : Can't open dsspfile "1jroB1.bssp"
#ERROR : Can't open dsspfile "1fiqC1.bssp"
#ERROR : Can't open dsspfile "1dgjA3.bssp"
#ERROR : Can't open dsspfile "1fm0E.bssp"

## Summary of PDB Search
:781
    e-168  36%  1t3qB2 [d.133.1.1] QUINOLINE 2-OXIDOREDUCTASE LARGE SUBUNIT B:166
    e-161  38%  1ffuB2 [d.133.1.1] CUTL, MOLYBDOPROTEIN OF CARBON MONOXIDE B:147 --
    e-160  27%  1rm6A2 [d.133.1.1] 4-HYDROXYBENZOYL-COA REDUCTASE ALPHA SUBUNIT
    e-150  23%  1fiqC2 [d.133.1.1] XANTHINE OXIDASE C:695 -- 1315
    e-123  23%  1dgjA4 [d.133.1.1] ALDEHYDE OXIDOREDUCTASE A:311 -- 906
    2e-39   5%  1hi9A  [c.99.1.1] DIPEPTIDE TRANSPORT PROTEIN DPPA
    2e-33  46%  1ffuB1 [d.41.1.1] CUTL, MOLYBDOPROTEIN OF CARBON MONOXIDE B:7 --
    7e-26  29%  1fo4A3 [d.41.1.1] XANTHINE DEHYDROGENASE A:537 -- 694
    1e-25  32%  1jroB1 [d.41.1.1] XANTHINE DEHYDROGENASE, CHAIN B B:2 -- 123
    2e-25  29%  1fiqC1 [d.41.1.1] XANTHINE OXIDASE C:571 -- 694
    7e-23  23%  1dgjA3 [d.41.1.1] ALDEHYDE OXIDOREDUCTASE A:194 -- 310
    2e-14  14%  1fm0E  [d.41.5.1] MOLYBDOPTERIN CONVERTIN FACTOR, SUBUNIT 2
:781

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MGIEGIGASVVRKEDRRFITGKGRYVDDIKILGMTYAHFVRSPHAHAKIKNIDVEAAKAMPGVVDVLTGQ
1t3qB2          ----------------------------------------------------------------------
1ffuB2          ----------------------------------------------------------------------
1rm6A2          ----------------------------------------------------------------------
1fiqC2          ----------------------------------------------------------------------
1dgjA4          ----------------------------------------------------------------------
1hi9A           ----------------------------------------------------------------------
1ffuB1          LALAGMGASRLRKEDARFIQGKGNYVDDIKMPGMLHMDIVRAPIAHGRIKKIHKDAALAMPGVHAVLTAE
1fo4A3          ----TVGRPLPHLAAAMQASGEAVYCDDIPRYNELFLRLVTSTRAHAKIKSIDVSEAQKVPGFVCFLSAD
1jroB1          -----VGKPLPHDSARAHVTGQARYLDDLPCPNTLHLAFGLSTEASAAITGLDLEPVRESPGVIAVFTA-
1fiqC1          -----VGRPLPHLAAAMQASGEAVYCDDIPRYNELFLRLVTSTRAHAKIKSIDVSEAQKVPGFVCFLSAD
1dgjA3          ---------------------EFGADAALRMPNTLHLALAQAKVSHALIKGIDTSEAEKMPGVYKVLTHK
1fm0E           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           QIVDDKVGNLICGWAIHSKDGSAMKMGAWPAMAPETVRFVGQAVAVVIAESKNLARDxxxxxxxxxxxxx
1t3qB2          ----------------------------------------------------------------------
1ffuB2          ----------------------------------------------------------------------
1rm6A2          ----------------------------------------------------------------------
1fiqC2          ----------------------------------------------------------------------
1dgjA4          ----------------------------------------------------------------------
1hi9A           ----------------------------------------------------------------------
1ffuB1          DLKPLKLH-----------WMPTLAGDVAAVLADEKVHFQMQEVAIVIADDRYIAAD-------------
1fo4A3          DIPG---------------SNETGLFNDETVFAKDTVTCVGHIIGAVVADTPEHAER-------------
1jroB1          ---ADLPHDNDASPAPS----------PEPVLATGEVHFVGQPIFLVAATSHRAAR--------------
1fiqC1          DIPGSNET---------------GLFNDETVFAKDTVTCVGHIIGAVVADTPEHAER-------------
1dgjA3          DVKGKNR-----ITGLITFPTNKGDGWERPILNDSKIFQYGDALAIVCADSEANAR--------------
1fm0E           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxQLHPEAPGNIVYDWEIGDQKAVDEAFGKAANVVSFELTNNRLVPNAMEPRAAIADY
1t3qB2          ---------------------------RARDE---LAPIFASSAGVVRGQFSCGRVSACPMETRGAVAQY
1ffuB2          -------------------EHHNHIFTWGAGDKAATDAVFANAPVTVSQHMYYPRVHPCPLETCGCVASF
1rm6A2          --------------ALHDDKPNNILREAEFGD---VAAAFAEADLIREKTYTFAEVNHVHMELNATLAEY
1fiqC2          -------------------KNNSFYGSELKIEKGDLKKGFSEADNVVSGELYIGGQDHFYLETHCTIAIP
1dgjA4          --------------EIHPGTPNVYYDQLEEKGEDTVPFFNDPANVVAEGSYYTQRQPHLPIEPDVGYGYI
1hi9A           ----------------------------------------------------------------------
1ffuB1          ----------------------------------------------------------------------
1fo4A3          ----------------------------------------------------------------------
1jroB1          ----------------------------------------------------------------------
1fiqC1          ----------------------------------------------------------------------
1dgjA3          ----------------------------------------------------------------------
1fm0E           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           NSAEEHFTLYTTSQNPHVARLVLSAFYNIAPEHKLRVVAPDVGGGFGSKIFIYPEEMVALWASKKVGRAV
1t3qB2          EWTTQQLILWTATQMPSFVRTMVAMFCAI-PEHLIEVRVPDVGGGFGQKAHLHPEELLVCLLSRALGRPV
1ffuB2          DPIKGDLTTYITSQAPHVVRTVVSMLSGI-PESKVRIVSPDIGGGFGNKVGIYPGYVCAIVASIVLGRPV
1rm6A2          DPVRDMLTLNTTTQVPYYVHLKVAACLQM-DSARIRVIKPFLGGGFGARTEALHFEIIAGLLARKAKGTV
1fiqC2          KGEEGEMELFVSTQNAMKTQSFVAKMLGV-PVNRILVRVKRMGGGFGGKERSTLVSVAVALAAYKTGHPV
1dgjA4          N-EQGQVVIHSKSVAIHLHALMIAPGLGLEFPKDLVLVQNTTGGTFGYKFSPTMEALVG-VAVMATGRPC
1hi9A           ----------------------------------------------------------------------
1ffuB1          ----------------------------------------------------------------------
1fo4A3          ----------------------------------------------------------------------
1jroB1          ----------------------------------------------------------------------
1fiqC1          ----------------------------------------------------------------------
1dgjA3          ----------------------------------------------------------------------
1fm0E           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           KWTGDRSEAFLTDAHGRDHVSKAELAFDADNRMLALRVKTHANFGAYMSLFSSSVPTYLYATLLSGQYNI
1t3qB2          RWIEDRQENFLGATHAKQQRNEMGLAFDGDGRFLALENRSITDGGAYNNLPTQLVESHVGNAVILGVYKV
1ffuB2          KWVEDRVENISTTAFARDYHMDGELAATPDGKILGLRVNVVADHGAFDACADPTKFPAGLFHICSGSYDI
1rm6A2          RLLQTREETFIAHRGRPWTEVKMKIGLKKDGKIAALALEATQAGGAYAGY---GIITILYTALMHGLYHI
1fiqC2          RCMLDRNEDMLITGGRHPFLARYKVGFMKTGTIVALEVDHYSNAGNSRDLSHSIMERA--LFHMDNCYKI
1dgjA4          HLRYNYEQQQNYTGKRSPFWTTMRYAADRQGKILAMETDWSVDHGPYSEF--GDLLTLRGAQYIGAGYGI
1hi9A           ----------------------------------------------------------------------
1ffuB1          ----------------------------------------------------------------------
1fo4A3          ----------------------------------------------------------------------
1jroB1          ----------------------------------------------------------------------
1fiqC1          ----------------------------------------------------------------------
1dgjA3          ----------------------------------------------------------------------
1fm0E           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           PAIYAEVIGVYTNTTPVDAYRGAGRPEACYLVERLVETAARQLKVDPAELRRKNFITQFPHQTPVIMAYD
1t3qB2          PAVSEESIAVATNKCPIGAYRGVGFTAGQIARETLIDRAARQLGLSPFEIRRRNVVMDFPFTNRLGQTHR
1ffuB2          PRAHCSVKGVYTNKAPGGVAYSFRVTEAVYLIERMVDVLAQKLNMDKAEIRAKNFIRQFPYTTQFGFEYD
1rm6A2          PAIKHDAWRVYTNTPPCGAMRGHGTVDTRAAFEALLTEMGEELGIDSLKIRQINMLPQIPYVTMYAQRVM
1fiqC2          PNIRGTGRLCKTNLSSNTAFRGFGGPQALFIAENWMSEVAVTCGLPAEEVRWKNMYKEGD-LTHFNQRLE
1dgjA4          ANIRGTGRTVATNHCWGAAFRGYGAPESEFPSEVLMDELAEKLGMDPFELRALNCY-REGDTTSSGQIPE
1hi9A           -----------------------------LYMSVDMEGISGLPDDTFVDSGKRNYEGRLIMTEEANYCIA
1ffuB1          ----------------------------------------------------------------------
1fo4A3          ----------------------------------------------------------------------
1jroB1          ----------------------------------------------------------------------
1fiqC1          ----------------------------------------------------------------------
1dgjA3          ----------------------------------------------------------------------
1fm0E           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           IGDFGASLDAALKAADYSXXXXXXXXXXXXXXXXXXXFSCYIEACGIAPSKAVGSLGAGVGLWESAEVRV
1t3qB2          EGTYLQTINLLEEMVNPEAFRQRQAEARARGKYLGLGVSVFNEVTGTGTR-TLSFLGTPTTTHDSATVRI
1ffuB2          SGDYHTALKKVLDAVDYPALRAEQAARRADPNSPTLMGVTFTEVVGAGPSKMCDILG--VGMFDSCEIRI
1rm6A2          SYGVPECLEKVKAASGWEERKGKLPKGRGLGIA----LSHFVSGTST-PKHWTGEPHATV------NLKL
1fiqC2          GFSVPRCWDECLKSSQYYARKSEVDKFNKENCWKKRGLCIIPTKFGISFT-------VPFLNQAGALIHV
1dgjA4          VMSLPEMFDKMRPYYEES-------------KKRVKERSTAEIKRGVGVALGVYGAGLDGPDTSEAWVEL
1hi9A           EAFNSGCTEVLVNDSHSKMNNLMVEKLHPEADLISGDVPFSMVEGLDDTFRGALFLGYHARASPGVMSHS
1ffuB1          ----------------------------------------------------------------------
1fo4A3          ----------------------------------------------------------------------
1jroB1          ----------------------------------------------------------------------
1fiqC1          ----------------------------------------------------------------------
1dgjA3          ----------------------------------------------------------------------
1fm0E           ----------------------------------------------FSVGEEYPWLAER----DEDGAVV


                         *         .         .         .         .         +         .:560
query           NPVGTIEILTGSHSHGQGHETTFAQLVADRLGIPINQVSIVHGDTDKVQFGMGTYGSRSAAVGMSAIFXX
1t3qB2          DPTGKVTVTTSLASSGQGHETTLAQIAADVLGVPASDVVIQAGSTKNT-YGFGAYASRGAVIGAGSIGRA
1ffuB2          HPTGSAIARMGTITQGQGHQTTYAQIIATELGIPSEVIQVEEGDTSTAPYGLGTYGSRSTPVAGAAIALA
1rm6A2          DFDGGITLLTGAADIGQGSNTMASQVAAEVLGVRLSRIRVISADSALTPKDNGSYSSRVTFMVGNASISA
1fiqC2          YTDGSVLVSHGGTEMGQGLHTKMVQVASKALKIPISKIYISETSTNTVPNSSPTAASVSTDIYGQAVYEA
1dgjA4          NDDGSVTLGNSWEDHGQGADAGSLGTAHRPLGITPENIHLVMNDTSKTPNSGPAGGSRSQVVTGNAIRVA
1hi9A           MIFGVRHFYINDRPVGELGLNAYVAGYYDVVLMVAGDDRAAKEAEELIPNVAVKQTISRSAVKCLSPAKR
1ffuB1          ----------------------------------------------------------------------
1fo4A3          ----------------------------------------------------------------------
1jroB1          ----------------------------------------------------------------------
1fiqC1          ----------------------------------------------------------------------
1dgjA3          ----------------------------------------------------------------------
1fm0E           TFTGKVRVNALTLEHYPGMTEKALAEIVDEARWPLGRVTVIHRIGELWPGDEIVFVGVTSAHRSSA----


                         .         .         .         *         .         .         .:630
query           XXXXXXXXXXXXXHQLEASEGDIVIENGEFKVTGTDKSIALPMVALAAYTAHNLPDGMEPGLKESAFYDP
1t3qB2          ASIVRERVKQLAGHLLEAASEDIVIEDGLVHVAGVPKGMPFAEVVGAAYFADTHPPGFDATLEATATYDP
1ffuB2          ARKIHAKARKIAAHMLEVNENDLDWEVDRFKVKGDDSKFK-TMADIAWQAYHQPPAGLEPGLEAVHYYDP
1rm6A2          AEELKGVLVKAAAKKLDAREEDIEVIDEMFMVSGSDPGLSFQEVVKAAMVDYTCPTEFQGDKKIRGSAIG
1fiqC2          CQTILKRLEPFKKKNPDGSWEDWVMAAYQDRVSLSTT---------GFYRTPNLGYSFETNSGNAFHY--
1dgjA4          CEMLIEGMRKPGGGFFTPAEMKAEGRPMRYDG-----------------------KWTAPAKDCDAKGQG
1hi9A           GRLLTEKTAFALQNKDKVKPLTP---PDRPVLSIEFANYGQAEWANLMP-------GTEIKTGTTTVQFQ
1ffuB1          ----------------------------------------------------------------------
1fo4A3          ----------------------------------------------------------------------
1jroB1          ----------------------------------------------------------------------
1fiqC1          ----------------------------------------------------------------------
1dgjA3          ----------------------------------------------------------------------
1fm0E           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           TNFTFPAGAYICELEVDPGTGKTSFVNFVAVDDFGRLINPMIVEGQVHGGLVQGIGQALLENAIYDETGQ
1t3qB2          SDLVLANGGHAAIVEIDASTYATRVTDFFAVEDCGTMINPMIVEGQIRGGIAQAIGQTLLEEVIYDDFGQ
1ffuB2          PNFTYPFGIYLCVVDIDRATGETKVRRFYALDDCGTRINPMIIEGQIHGGLTEGYAVAMGQQMPFDAQGN
1rm6A2          ATMGFCYAAQVVEASVDEITGKVTAHKVWVAVDVGKALNPLAVEGQTQGGVWMGMGQALSEETVYDN-GR
1fiqC2          ----FTYGVACSEVEIDCLTGDHKNLRTDIVMDVGSSLNPAIDIGQVEGAFVQGLGLFTLEELHYSPEGS
1dgjA4          SPFCYMYGLFLTEVAVEVATGKATVEKMVCVADIGKICNKLVVDGQIYGGLAQGVGLALSE----DYEDL
1hi9A           AKDMLEAY-QAMLVMTELAMR-------------------------------------------------
1ffuB1          ----------------------------------------------------------------------
1fo4A3          ----------------------------------------------------------------------
1jroB1          ----------------------------------------------------------------------
1fiqC1          ----------------------------------------------------------------------
1dgjA3          ----------------------------------------------------------------------
1fm0E           ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           LVTASFMDYAMPRADDVPSFKVSHTETLCPGNPLGVKGCGEAGAIGASAAVINAITDAIGHNRLEMPATP
1t3qB2          LVTTTLMDYLIPTTLDVPDIRIRHLETPSPLVPGGIKGMGESAMISAPAAVVAAVNDHLEVVIETVPITP
1ffuB2          LLGNTLMDYFLPTAVETPHWETDHTVTPSPHHPIGAKGVAESPHVGSIPTFTAAVVDAFGVTHLDMPHTS
1rm6A2          MVHGNILDYRVPTIVESPDIEVIIVESMDPNGPFGAKEASEGMLAGFLPAIHEAVYEAVGVRATDFPLSP
1fiqC2          LHTRGPSTYKIPAFGSIPTEFRVSRDCPNKKAIYASKAVGEPPLFLGAFAIKDAIRAARAQHRLDSPATP
1dgjA4          KKHSTMGGAGIPSIKMIPDIEIVYVETPRKDGPFGASGVGEMPLTAPHAAIINGIYNACGARVRHLPARP
1hi9A           ----------------------------------------------------------------------
1ffuB1          ----------------------------------------------------------------------
1fo4A3          ----------------------------------------------------------------------
1jroB1          ----------------------------------------------------------------------
1fiqC1          ----------------------------------------------------------------------
1dgjA3          ----------------------------------------------------------------------
1fm0E           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           DRVWHAIHGxx
1t3qB2          ERIFRSIQ---
1ffuB2          YRVWKSLK---
1rm6A2          DRITELLDA--
1fiqC2          EKIRNACV---
1dgjA4          EKVLEAM----
1hi9A           -----------
1ffuB1          -----------
1fo4A3          -----------
1jroB1          -----------
1fiqC1          -----------
1dgjA3          -----------
1fm0E           -----------