[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for rpal2:ABE38351.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1gzjA.bssp"
#ERROR : Can't open dsspfile "1pz2A2.bssp"
#ERROR : Can't open dsspfile "1a3hA.bssp"
#ERROR : Can't open dsspfile "1gowA.bssp"
#ERROR : Can't open dsspfile "2vzsA5.bssp"
#ERROR : Can't open dsspfile "1bglA5.bssp"
#ERROR : Can't open dsspfile "1m1cA.bssp"
#ERROR : Can't open dsspfile "1fhlA.bssp"
#ERROR : Can't open dsspfile "1qnoA.bssp"

## Summary of PDB Search
:440
    5e-09  18%  1gzjA  [c.1.8.3] ENDO TYPE CELLULASE ENGI
    2e-06   9%  1pz2A2 [c.1.8.3] ALPHA-L-ARABINOFURANOSIDASE A:18 -- 384
    2e-06  32%  1a3hA  [c.1.8.3] ENDOGLUCANASE
    2e-06  17%  1gowA  [c.1.8.4] BETA-GLYCOSIDASE
    3e-05  14%  2vzsA5 [c.1.8.3] EXO-BETA-D-GLUCOSAMINIDASE A:336 -- 674
    5e-05  15%  1bglA5 [c.1.8.3] BETA-GALACTOSIDASE A:334 -- 625
    6e-05  14%  1m1cA  [e.42.1.1] MAJOR COAT PROTEIN
    6e-05  11%  1fhlA  [c.1.8.3] BETA-1,4-GALACTANASE
    3e-04  14%  1qnoA  [c.1.8.3] ENDO-1,4-B-D-MANNANASE
:440

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxNGYLSTSGSQIVDASGRPVRIASIGWNGTEGPLGAAP
1gzjA           ---------------------------------------------------------GAEFGSQNLPGVE
1pz2A2          ----------------------------------------------------------------------
1a3hA           ----------------------------------------------------------------------
1gowA           ----------------------------------------------------------------------
2vzsA5          ----------------------------------------------------------------------
1bglA5          ----------------------------------------------------------------------
1m1cA           ----------------------------------------------------------------------
1fhlA           ----------------------------------------------------------------------
1qnoA           ---------------------------------SSFVTISGTQFNI-DGKVGYFAGTNCYWCSF------


                         .         .         *         .         .         .         .:140
query           SGIWRVSYKTVLDSIVAAGFNAVRIPWTDIGLNAPLNGYSDRLGWINITLNPELLASSTPNSQGRYQYVT
1gzjA           GKDYIWPDPNTIDTLISKGMNIFRVPFMMERLVPNSMTGSPDPNYLAD----------------------
1pz2A2          -------RQDVIELVKELQVPIIRYP-----------GGNFVSGYNWEDGVGPKEQRPRRLDLAWKSVET
1a3hA           ----------------------------------------------------------------------
1gowA           -------YKTFHDNAQKMGLKIARLNWSRQFPNPLPRPQNFD-ESKQDVTEVEINENELKRLDEYANK-D
2vzsA5          ----------------------------------------------------------------------
1bglA5          -------------------------------------------------------------------QVM
1m1cA           ------------VNIPKFGSIRGRYP---------------------FLLSGDAALI-------QATALE
1fhlA           -----------------------------------------------------------RVWVNPSDGSY
1qnoA           -LTNHADVDSTFSHISSSGLKVVRVWGFN---DVNTQPSPGQIWFQKLSATGSTINTGA----------D


                         +         .         .         .         .         *         .:210
query           TLVAFQRIVDYAQEIGLKVIFNHHTNQGTAGQQRNGLWFDLGPGTDNTDGIVPGRVTAETFKQNWLLVAR
1gzjA           ----LIATVNAITQKGAYAVVDPHNYGRYYNSIIS---------------------SPSDFQTFWKTVAS
1pz2A2          NEIGLNEFMDWAKMVGAEVNMAVNL-------------GTRGIDAARNLVEYCNHPSGSYYS--DLRIAH
1a3hA           -------------------------------------------------------------KDFFDEMSE
1gowA           ALNHYREIFKDLKSRGLYFIQNMYHWPLPLWLHDPIRVRRGDFTGPSG---WLSTRTVYEFARFSAYTAW
2vzsA5          ------EFFDIADDLGVLTMPGWECC-----------DKWEGQVNGEEKGEPWVESDYPIAKASMFSEAE
1bglA5          DEQTMVQDILLMKQNNFNAVRCSHYPNHPLWYTRYGLYNIETHGMVPMNRLTDDPRWLPAMSERVTRMVQ
1m1cA           DWSAIMAKPELVFTYAMQVSVALNTRVKKTGFGTTIDDS-----YEDG-----AFLQPETFVQAALACCG
1fhlA           DLDYNLELAKRVKAAGMSLYLDLHLSDTWAD------PSDQTTPSGWSTTDLGTLK--WQLYNYTLEVCN
1qnoA           GLQTLDYVVQSAEQHNLKLIIPFVNN--WSDYGGINAYVNAFGGNATTWYTNTAAQTQYRKYVQA--VVS


                         .         .         .         +         .         .         .:280
query           TFANNPTVIGYDLHNEPNGDRGHITWGGGGPTDIKAMCEDVGSAIQDVSPGVLIICEGPETYKPPPASSG
1gzjA           QFASNPLVI-FDTNN---------EYHDMDQTLVLNLNQAAIDGIRSAGATSQYIFVEGNSWTGAWTWTN
1pz2A2          GYKEPHKIKTWCLGNAMD---GPWQIGHKTAVEYGRIACEAAKVMKWVDPTIELVVCGSSNRNMPTFAEW
1a3hA           LYGDYPNVI-YEIANEPNG--SDVTWG----NQIKPYAEEVIPIIRNNDPNNIIIV-GTGTW-----SQD
1gowA           KF--DDLVDEYSTMNEPNVV--------------------------------------------------
2vzsA5          RLRDHPSVISFHIGSDFAPDRRIEQGYLDAADFLLPVIPAASARPSPITGASGMKMNGPYDYVPP-----
1bglA5          RDRNHPSVIIWSLGNESGHGANH-----------------------------------------------
1m1cA           QDAPLNGMSDVYVTYPD-----------------------------------------------------
1fhlA           TFAENDIDIEISIGNEIRAGLLWPLGETSSYSNIGALLHSGAWGVKDSNLATTPKIMIHLDDGWSWDQQN
1qnoA           RYANSTAIFAWELGNEPRCNGCSTDVIVQWATSVSQYVKSLDSNHLVTLGDEGLGLSTGDGAYPYTYGEG


                         .         *         .         .         .         .         +:350
query           MDPRHXXXXXXXXXXXXXXVKLKIANKLVYSIHEYPDEISDTKRWGLPEVGKGFIDRMNFTWGYLVRDNI
1gzjA           VNDNMKSLTDP-------------SDKIIYEMHQYLD--SDGSGTSATCVSSTIGQERITSATQWLRANG
1pz2A2          EATVL---------------DHTYDHVDYISLHDNDTANYLALSLEMDDFIRSVVAIADYVKAKKRSKKT
1a3hA           VHH-------------AADNQLADPN-VMYAFHFYAGTHGQNLR-----------DQVDY-----ALDQG
1gowA           ----------------------------------------------------------------------
2vzsA5          ----------------------------------------------------------------------
1bglA5          ----------------------------------------------------------------------
1m1cA           ----------------------------------------------------------------------
1fhlA           YF----------YETVLATGELLSTDFDYFGVSYYP-----------FYSASATLASLKTSLANLQSTYD
1qnoA           TDFA------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           APVWIGEMGASLRTPETREWARNLIDYMNGKYGQEGGPTFSGDQQPVSGSWWLIGPSNDPPFGLQTEWGV
1gzjA           KKGIIGEFAGGANDV-CETAITGMLDYM-----AQNTDVWTGAIWWAAGPWW------------------
1pz2A2          IHLSFDEWNVWYHSNEADKLIEP--WTVAPPLLEDIYNFEDALL-----VGCMLITLMKHADRVKIACLA
1a3hA           AAIFVSEWGTSAATDEAQVW----IDFMDER---------------------------------------
1gowA           ----------------------------------------------------------------------
2vzsA5          ----------------------------------------------------------------------
1bglA5          ----------------------------------------------------------------------
1m1cA           ----------------------------------------------------------------------
1fhlA           KPVVVVETNWPVSCPNPAYAFPSDLSSIP-----------------------------------------
1qnoA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           GNYRPDQIAITDxxxxxxxx
1gzjA           --------------------
1pz2A2          QLVNVIAPIMTE--------
1a3hA           --------------------
1gowA           --------------------
2vzsA5          --------------------
1bglA5          --------------------
1m1cA           --------------------
1fhlA           --------------------
1qnoA           --------------------