[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for rpal2:ABE38359.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1b0uA.bssp"
#ERROR : Can't open dsspfile "1sgwA.bssp"
#ERROR : Can't open dsspfile "1ji0A.bssp"
#ERROR : Can't open dsspfile "1m3eA1.bssp"
#ERROR : Can't open dsspfile "1nijA1.bssp"
#ERROR : Can't open dsspfile "1q3hA.bssp"
#ERROR : Can't open dsspfile "1ex6A.bssp"
#ERROR : Can't open dsspfile "1l7vC.bssp"
#ERROR : Can't open dsspfile "1mukA.bssp"
#ERROR : Can't open dsspfile "1khbA1.bssp"
#ERROR : Can't open dsspfile "1e69A.bssp"
#ERROR : Can't open dsspfile "1zs3A1.bssp"
#ERROR : Can't open dsspfile "1bgxT2.bssp"
#ERROR : Can't open dsspfile "1e9rA.bssp"
#ERROR : Can't open dsspfile "1kgdA.bssp"
#ERROR : Can't open dsspfile "1pf4A1.bssp"
#ERROR : Can't open dsspfile "1ffhA2.bssp"
#ERROR : Can't open dsspfile "1urjA.bssp"
#ERROR : Can't open dsspfile "1t06A.bssp"
#ERROR : Can't open dsspfile "2gk3A1.bssp"
#ERROR : Can't open dsspfile "1jjvA.bssp"
#ERROR : Can't open dsspfile "2gx8A1.bssp"
#ERROR : Can't open dsspfile "1mjgM.bssp"
#ERROR : Can't open dsspfile "2yyeA2.bssp"
#ERROR : Can't open dsspfile "1qhlA.bssp"
#ERROR : Can't open dsspfile "1udwA.bssp"
#ERROR : Can't open dsspfile "1e6cA.bssp"
#ERROR : Can't open dsspfile "1n25A.bssp"
#ERROR : Can't open dsspfile "1jalA1.bssp"
#ERROR : Can't open dsspfile "1bmfA3.bssp"
#ERROR : Can't open dsspfile "1f46A.bssp"
#ERROR : Can't open dsspfile "1es6A2.bssp"
#ERROR : Can't open dsspfile "1mm8A.bssp"
#ERROR : Can't open dsspfile "1d6jA.bssp"
#ERROR : Can't open dsspfile "1t3wA.bssp"
#ERROR : Can't open dsspfile "1xbtA1.bssp"
#ERROR : Can't open dsspfile "1j1zA2.bssp"
#ERROR : Can't open dsspfile "1f2t.1.bssp"
#ERROR : Can't open dsspfile "2v3jA1.bssp"
#ERROR : Can't open dsspfile "1cr0A.bssp"
#ERROR : Can't open dsspfile "1vplA.bssp"
#ERROR : Can't open dsspfile "1tljA.bssp"
#ERROR : Can't open dsspfile "2iqhA1.bssp"
#ERROR : Can't open dsspfile "1ohcA1.bssp"
#ERROR : Can't open dsspfile "1fl9A.bssp"
#ERROR : Can't open dsspfile "1zp6A1.bssp"
#ERROR : Can't open dsspfile "1jb1A.bssp"
#ERROR : Can't open dsspfile "1c4oA1.bssp"
#ERROR : Can't open dsspfile "1tmkA.bssp"
#ERROR : Can't open dsspfile "1i1qA.bssp"
#ERROR : Can't open dsspfile "1g6hA.bssp"
#ERROR : Can't open dsspfile "1jbkA.bssp"
#ERROR : Can't open dsspfile "1np6A.bssp"
#ERROR : Can't open dsspfile "2vgmA3.bssp"
#ERROR : Can't open dsspfile "1l3aA.bssp"
#ERROR : Can't open dsspfile "2f9hA1.bssp"
#ERROR : Can't open dsspfile "1pv4A3.bssp"
#ERROR : Can't open dsspfile "1cd5A.bssp"
#ERROR : Can't open dsspfile "1lw7A2.bssp"
#ERROR : Can't open dsspfile "1s9hA.bssp"
#ERROR : Can't open dsspfile "2pa7A1.bssp"
#ERROR : Can't open dsspfile "2axpA1.bssp"
#ERROR : Can't open dsspfile "1ak2A1.bssp"
#ERROR : Can't open dsspfile "1g8yA.bssp"
#ERROR : Can't open dsspfile "1g6oA.bssp"
#ERROR : Can't open dsspfile "1qhdA1.bssp"
#ERROR : Can't open dsspfile "1e3mA2.bssp"
#ERROR : Can't open dsspfile "2fggA1.bssp"
#ERROR : Can't open dsspfile "2qgmA1.bssp"
#ERROR : Can't open dsspfile "1gm5A1.bssp"
#ERROR : Can't open dsspfile "1viaA.bssp"
#ERROR : Can't open dsspfile "2ancF1.bssp"
#ERROR : Can't open dsspfile "1f8xA.bssp"
#ERROR : Can't open dsspfile "1dnpA2.bssp"
#ERROR : Can't open dsspfile "1grqA.bssp"
#ERROR : Can't open dsspfile "2vnuD1.bssp"
#ERROR : Can't open dsspfile "1bccF.bssp"
#ERROR : Can't open dsspfile "1ii8.1.bssp"
#ERROR : Can't open dsspfile "1bs2A1.bssp"
#ERROR : Can't open dsspfile "1yvuA2.bssp"
#ERROR : Can't open dsspfile "1ni3A1.bssp"
#ERROR : Can't open dsspfile "1rkbA.bssp"
#ERROR : Can't open dsspfile "1em8A.bssp"
#ERROR : Can't open dsspfile "1o7d.2.bssp"
#ERROR : Can't open dsspfile "1v47A1.bssp"
#ERROR : Can't open dsspfile "1poiA.bssp"
#ERROR : Can't open dsspfile "1ckvA.bssp"
#ERROR : Can't open dsspfile "1afrA.bssp"
#ERROR : Can't open dsspfile "1t9hA2.bssp"
#ERROR : Can't open dsspfile "3cddA2.bssp"
#ERROR : Can't open dsspfile "1iqrA2.bssp"
#ERROR : Can't open dsspfile "1w1wA.bssp"
#ERROR : Can't open dsspfile "1dhyA1.bssp"
#ERROR : Can't open dsspfile "3cddA1.bssp"
#ERROR : Can't open dsspfile "1l7lA.bssp"
#ERROR : Can't open dsspfile "1mi8A.bssp"
#ERROR : Can't open dsspfile "1dwmA.bssp"
#ERROR : Can't open dsspfile "1yj5A2.bssp"
#ERROR : Can't open dsspfile "1yr6A1.bssp"
#ERROR : Can't open dsspfile "1sbxA.bssp"
#ERROR : Can't open dsspfile "1atrA1.bssp"
#ERROR : Can't open dsspfile "1vhhA.bssp"
#ERROR : Can't open dsspfile "1d8jA.bssp"
#ERROR : Can't open dsspfile "1ovmA2.bssp"
#ERROR : Can't open dsspfile "1xl3C1.bssp"
#ERROR : Can't open dsspfile "1g31A.bssp"
#ERROR : Can't open dsspfile "1esmA.bssp"
#ERROR : Can't open dsspfile "1jqjA3.bssp"
#ERROR : Can't open dsspfile "2gtlM1.bssp"
#ERROR : Can't open dsspfile "1iioA.bssp"
#ERROR : Can't open dsspfile "2gujA1.bssp"
#ERROR : Can't open dsspfile "1uouA3.bssp"
#ERROR : Can't open dsspfile "1g8fA3.bssp"
#ERROR : Can't open dsspfile "1a4iA2.bssp"
#ERROR : Can't open dsspfile "1ckeA.bssp"
#ERROR : Can't open dsspfile "1b77A2.bssp"
#ERROR : Can't open dsspfile "1pgsA2.bssp"
#ERROR : Can't open dsspfile "1oa8A.bssp"
#ERROR : Can't open dsspfile "1tueA.bssp"
#ERROR : Can't open dsspfile "2je6I3.bssp"
#ERROR : Can't open dsspfile "1jqjA2.bssp"
#ERROR : Can't open dsspfile "1sfjA.bssp"
#ERROR : Can't open dsspfile "1e2hA.bssp"
#ERROR : Can't open dsspfile "1heiB1.bssp"
#ERROR : Can't open dsspfile "1odfA.bssp"
#ERROR : Can't open dsspfile "1b0uA.bssp"
#ERROR : Can't open dsspfile "1sgwA.bssp"
#ERROR : Can't open dsspfile "1ji0A.bssp"
#ERROR : Can't open dsspfile "1m3eA1.bssp"
#ERROR : Can't open dsspfile "1nijA1.bssp"
#ERROR : Can't open dsspfile "1ex6A.bssp"
#ERROR : Can't open dsspfile "1l7vC.bssp"
#ERROR : Can't open dsspfile "1mukA.bssp"
#ERROR : Can't open dsspfile "1bgxT2.bssp"
#ERROR : Can't open dsspfile "1pf4A1.bssp"
#ERROR : Can't open dsspfile "1t06A.bssp"
#ERROR : Can't open dsspfile "1jjvA.bssp"
#ERROR : Can't open dsspfile "2gx8A1.bssp"
#ERROR : Can't open dsspfile "1n25A.bssp"
#ERROR : Can't open dsspfile "1mm8A.bssp"
#ERROR : Can't open dsspfile "1f2t.1.bssp"
#ERROR : Can't open dsspfile "1tmkA.bssp"
#ERROR : Can't open dsspfile "2vgmA3.bssp"
#ERROR : Can't open dsspfile "2pa7A1.bssp"
#ERROR : Can't open dsspfile "1ii8.1.bssp"
#ERROR : Can't open dsspfile "1uouA3.bssp"

## Summary of PDB Search
:539
    1e-34  26%  1b0uA  [c.37.1.12] HISTIDINE PERMEASE
    3e-33  19%  1sgwA  [c.37.1.12] PUTATIVE ABC TRANSPORTER
    7e-33  28%  1ji0A  [c.37.1.12] ABC TRANSPORTER
    3e-30  10%  1m3eA1 [c.124.1.2] SUCCINYL-COA:3-KETOACID-COENZYME A TRANSFERASE
    4e-28  14%  1nijA1 [c.37.1.10] HYPOTHETICAL PROTEIN YJIA A:2 -- 223
    1e-27  17%  1q3hA  [c.37.1.12] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-25  11%  1ex6A  [c.37.1.1] GUANYLATE KINASE
    1e-24  26%  1l7vC  [c.37.1.12] VITAMIN B12 TRANSPORT ATP-BINDING PROTEIN BTUD
    2e-24  11%  1mukA  [e.8.1.4] MINOR CORE PROTEIN LAMBDA 3
    1e-23  10%  1khbA1 [c.91.1.1] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    3e-23  14%  1e69A  [c.37.1.12] CHROMOSOME SEGREGATION SMC PROTEIN
    2e-22  14%  1zs3A1 [a.25.1.1] LACTOCOCCUS LACTIS MG1363 DPSA A:3 -- 173
    3e-21  12%  1bgxT2 [c.120.1.2] TAQ DNA POLYMERASE T:1 -- 173
    4e-21  12%  1e9rA  [c.37.1.11] CONJUGAL TRANSFER PROTEIN TRWB
    2e-20   8%  1kgdA  [c.37.1.1] PERIPHERAL PLASMA MEMBRANE CASK
    2e-20  24%  1pf4A1 [c.37.1.12] TRANSPORT ATP-BINDING PROTEIN MSBA A:321 -- 564
    4e-20  12%  1ffhA2 [c.37.1.10] FFH A:89 -- 295
    2e-19  12%  1urjA  [e.58.1.1] MAJOR DNA-BINDING PROTEIN
    3e-19   8%  1t06A  [a.118.1.17] HYPOTHETICAL PROTEIN
    4e-19   8%  2gk3A1 [c.23.16.9] PUTATIVE CYTOPLASMIC PROTEIN A:8 -- 253
    6e-18  13%  1jjvA  [c.37.1.1] DEPHOSPHO-COA KINASE
    7e-18   7%  2gx8A1 [c.135.1.1] NIF3-RELATED PROTEIN A:4 -- 373
    9e-18  11%  1mjgM  [e.26.1.3] CARBON MONOXIDE DEHYDROGENASE ALPHA SUBUNIT
    1e-17  10%  2yyeA2 [d.139.1.1] SELENIDE, WATER DIKINASE A:155 -- 336
    2e-17  17%  1qhlA  [c.37.1.12] PROTEIN (CELL DIVISION PROTEIN MUKB)
    3e-17  15%  1udwA  [c.37.1.6] URIDINE-CYTIDINE KINASE 2
    3e-17  12%  1e6cA  [c.37.1.2] SHIKIMATE KINASE
    5e-17  10%  1n25A  [c.37.1.20] LARGE T ANTIGEN
    6e-17   8%  1jalA1 [c.37.1.8] YCHF PROTEIN A:1 -- 278
    1e-16  10%  1bmfA3 [c.37.1.11] BOVINE MITOCHONDRIAL F1-ATPASE A:95 -- 379
    2e-16   5%  1f46A  [d.129.4.1] CELL DIVISION PROTEIN ZIPA
    2e-16  12%  1es6A2 [b.31.1.1] MATRIX PROTEIN VP40 A:201 -- 321
    4e-16  15%  1mm8A  [c.55.3.4] TN5 TRANSPOSASE
    5e-16  12%  1d6jA  [c.37.1.4] ADENOSINE-5'PHOSPHOSULFATE KINASE
    8e-16  13%  1t3wA  [a.236.1.1] DNA PRIMASE
    8e-16  10%  1xbtA1 [c.37.1.24] THYMIDINE KINASE, CYTOSOLIC A:18 -- 150
    9e-16   8%  1j1zA2 [d.210.1.1] ARGININOSUCCINATE SYNTHETASE A:171 -- 395
    1e-15  30%  1f2t.1 [c.37.1.12] RAD50 ABC-ATPASE A:- -- - B:- -- -
    2e-15   4%  2v3jA1 [c.116.1.6] ESSENTIAL FOR MITOTIC GROWTH 1 A:23 -- 251
    2e-15  16%  1cr0A  [c.37.1.11] DNA PRIMASE/HELICASE
    3e-15  27%  1vplA  [c.37.1.12] ABC TRANSPORTER, ATP-BINDING PROTEIN
    4e-15   6%  1tljA  [d.282.1.1] HYPOTHETICAL UPF0130 PROTEIN SSO0622
    8e-15   7%  2iqhA1 [e.75.1.1] NUCLEOCAPSID PROTEIN A:21 -- 489
    9e-15   9%  1ohcA1 [c.45.1.1] CDC14B2 PHOSPHATASE A:42 -- 198
    1e-14  18%  1fl9A  [c.37.1.18] HYPOTHETICAL PROTEIN HI0065
    1e-14  13%  1zp6A1 [c.37.1.25] HYPOTHETICAL PROTEIN ATU3015 A:6 -- 181
    1e-14  12%  1jb1A  [c.91.1.2] HPRK PROTEIN
    2e-14  14%  1c4oA1 [c.37.1.19] DNA NUCLEOTIDE EXCISION REPAIR ENZYME UVRB A:2
    3e-14   8%  1tmkA  [c.37.1.1] THYMIDYLATE KINASE
    4e-14  13%  1i1qA  [d.161.1.1] ANTHRANILATE SYNTHASE COMPONENT I
    6e-14  26%  1g6hA  [c.37.1.12] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID
    6e-14  14%  1jbkA  [c.37.1.20] CLPB PROTEIN
    8e-14  13%  1np6A  [c.37.1.10] MOLYBDOPTERIN-GUANINE DINUCLEOTIDE BIOSYNTHESIS
    1e-13  10%  2vgmA3 [d.79.3.2] DOM34 A:278 -- 381
    2e-13  14%  1l3aA  [d.18.1.2] P24: PLANT TRANSCRIPTIONAL REGULATOR PBF-2
    3e-13  11%  2f9hA1 [b.161.1.1] PTS SYSTEM, IIA COMPONENT A:3 -- 123
    4e-13  13%  1pv4A3 [c.37.1.11] TRANSCRIPTION TERMINATION FACTOR RHO A:129 --
    6e-13  10%  1cd5A  [c.124.1.1] PROTEIN (GLUCOSAMINE 6-PHOSPHATE DEAMINASE)
    8e-13  13%  1lw7A2 [c.37.1.1] TRANSCRIPTIONAL REGULATOR NADR A:220 -- 411
    1e-12  11%  1s9hA  [c.37.1.20] REP 40 PROTEIN
    2e-12   9%  2pa7A1 [b.82.1.1] DTDP-6-DEOXY-3,4-KETO-HEXULOSE ISOMERASE A:2 --
    2e-12  11%  2axpA1 [c.37.1.1] HYPOTHETICAL PROTEIN BSU20280 A:2 -- 165
    7e-12  11%  1ak2A1 [c.37.1.1] ADENYLATE KINASE ISOENZYME-2 A:14 -- 146 A:177 --
    7e-12  11%  1g8yA  [c.37.1.11] REGULATORY PROTEIN REPA
    1e-11  12%  1g6oA  [c.37.1.11] CAG-ALPHA
    1e-11   2%  1qhdA1 [a.115.1.2] VIRAL CAPSID VP6 A:1 -- 148 A:333 -- 397
    1e-11  11%  1e3mA2 [c.37.1.12] DNA MISMATCH REPAIR PROTEIN MUTS A:567 -- 800
    2e-11  20%  2fggA1 [d.50.5.1] HYPOTHETICAL PROTEIN RV2632C/MT2708 A:4 -- 87
    2e-11   8%  2qgmA1 [c.150.1.3] SUCCINOGLYCAN BIOSYNTHESIS PROTEIN A:33 -- 445
    2e-11  13%  1gm5A1 [a.24.21.1] RECG A:7 -- 105
    3e-11  12%  1viaA  [c.37.1.2] SHIKIMATE KINASE
    5e-11  10%  2ancF1 [c.37.1.1] GUANYLATE KINASE F:3 -- 206
    1e-10   8%  1f8xA  [c.23.14.1] NUCLEOSIDE 2-DEOXYRIBOSYLTRANSFERASE
    2e-10  14%  1dnpA2 [c.28.1.1] DNA PHOTOLYASE A:1 -- 200
    2e-10   8%  1grqA  [c.37.1.3] CHLORAMPHENICOL 3-O PHOSPHOTRANSFERASE
    2e-10   6%  2vnuD1 [b.40.4.5] EXOSOME COMPLEX EXONUCLEASE RRP44 D:400 -- 494
    2e-10  14%  1bccF  [f.27.1.1] UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
    3e-10  18%  1ii8.1 [c.37.1.12] RAD50 ABC-ATPASE A:- -- - B:- -- -
    4e-10  17%  1bs2A1 [a.27.1.1] PROTEIN (ARGINYL-TRNA SYNTHETASE) A:484 -- 607
    5e-10  11%  1yvuA2 [c.55.3.10] HYPOTHETICAL PROTEIN AQ_1447 A:315 -- 706
    5e-10  14%  1ni3A1 [c.37.1.8] YCHF GTP-BINDING PROTEIN A:11 -- 306
    8e-10  11%  1rkbA  [c.37.1.1] PROTEIN AD-004
    2e-09  17%  1em8A  [c.128.1.1] DNA POLYMERASE III CHI SUBUNIT
    4e-09  11%  1o7d.2 [b.30.5.6] LYSOSOMAL ALPHA-MANNOSIDASE C:488 -- 585 D:603 --
    4e-09  12%  1v47A1 [b.122.1.3] ATP SULFURYLASE A:4 -- 135
    5e-09  11%  1poiA  [c.124.1.2] GLUTACONATE COENZYME A-TRANSFERASE
    7e-09   8%  1ckvA  [d.137.1.1] PROTEIN (PROTEIN B)
    3e-08   7%  1afrA  [a.25.1.2] DELTA9 STEAROYL-ACYL CARRIER PROTEIN DESATURASE
    3e-08   9%  1t9hA2 [c.37.1.8] PROBABLE GTPASE ENGC A:68 -- 298
    3e-08  10%  3cddA2 [b.106.1.1] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN A:2 -- 180
    3e-08  16%  1iqrA2 [c.28.1.1] PHOTOLYASE A:2 -- 171
    4e-08  21%  1w1wA  [c.37.1.12] STRUCTURAL MAINTENANCE OF CHROMOSOME 1
    5e-08  11%  1dhyA1 [d.32.1.3] 2,3-DIHYDROXYBIPHENYL 1,2-DIOXYGENASE A:1 -- 132
    5e-08  12%  3cddA1 [b.106.1.1] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN A:181 -- 348
    6e-08   8%  1l7lA  [b.18.1.16] PA-I GALACTOPHILIC LECTIN
    8e-08   8%  1mi8A  [b.86.1.2] DNAB INTEIN
    1e-07  12%  1dwmA  [d.40.1.1] LINUM USITATISSINUM TRYPSIN INHIBITOR
    1e-07  16%  1yj5A2 [c.37.1.1] 5' POLYNUCLEOTIDE KINASE-3' PHOSPHATASE A:351 --
    1e-07  11%  1yr6A1 [c.37.1.10] ATP(GTP)BINDING PROTEIN A:1 -- 244
    2e-07   7%  1sbxA  [a.6.1.4] SKI ONCOGENE
    2e-07  19%  1atrA1 [c.55.1.1] HEAT-SHOCK COGNATE 70 KD PROTEIN A:2 -- 188
    2e-07  15%  1vhhA  [d.65.1.2] SONIC HEDGEHOG
    3e-07  14%  1d8jA  [a.4.5.18] GENERAL TRANSCRIPTION FACTOR TFIIE-BETA
    4e-07  12%  1ovmA2 [c.36.1.5] INDOLE-3-PYRUVATE DECARBOXYLASE A:3 -- 180
    7e-07  15%  1xl3C1 [a.243.1.1] PROTEIN TYPE A C:2 -- 92
    1e-06  11%  1g31A  [b.35.1.1] GP31
    2e-06  10%  1esmA  [c.37.1.6] PANTOTHENATE KINASE
    2e-06   4%  1jqjA3 [d.131.1.1] DNA POLYMERASE III, BETA CHAIN A:245 -- 366
    4e-06   8%  2gtlM1 [b.61.7.1] HEMOGLOBIN LINKER CHAIN L1 M:102 -- 225
    9e-06   9%  1iioA  [a.39.4.1] CONSERVED HYPOTHETICAL PROTEIN MTH865
    2e-05  11%  2gujA1 [b.106.1.3] PHAGE-LIKE ELEMENT PBSX PROTEIN XKDM A:5 -- 143
    2e-05  11%  1uouA3 [d.41.3.1] THYMIDINE PHOSPHORYLASE A:374 -- 480
    4e-05   7%  1g8fA3 [c.37.1.15] SULFATE ADENYLYLTRANSFERASE A:390 -- 511
    4e-05   3%  1a4iA2 [c.58.1.2] METHYLENETETRAHYDROFOLATE DEHYDROGENASE / A:2 --
    8e-05  15%  1ckeA  [c.37.1.1] PROTEIN (CYTIDINE MONOPHOSPHATE KINASE)
    1e-04  13%  1b77A2 [d.131.1.2] PROTEIN (SLIDING CLAMP) A:111 -- 228
    2e-04   4%  1pgsA2 [b.121.1.1] PEPTIDE-N(4)-(N-ACETYL-BETA-D-GLUCOSAMINYL)
    2e-04  18%  1oa8A  [b.145.1.1] ATAXIN-1
    2e-04  16%  1tueA  [c.37.1.20] REPLICATION PROTEIN E1
    2e-04  26%  2je6I3 [d.51.1.1] EXOSOME COMPLEX RNA-BINDING PROTEIN 1 I:153 --
    4e-04  10%  1jqjA2 [d.131.1.1] DNA POLYMERASE III, BETA CHAIN A:123 -- 244
    4e-04  10%  1sfjA  [c.1.10.1] 3-DEHYDROQUINATE DEHYDRATASE
    4e-04  18%  1e2hA  [c.37.1.1] THYMIDINE KINASE
    5e-04  22%  1heiB1 [c.37.1.14] HCV HELICASE B:188 -- 325
    6e-04  15%  1odfA  [c.37.1.6] HYPOTHETICAL 33.3 KDA PROTEIN IN ADE3-SER2
    5e-12  13%  1b0uA  [c.37.1.12] HISTIDINE PERMEASE(query 280->505)
    1e-05  12%  1sgwA  [c.37.1.12] PUTATIVE ABC TRANSPORTER(query 408->503)
    5e-08  24%  1ji0A  [c.37.1.12] ABC TRANSPORTER(query 430->505)
    3e-04   6%  1m3eA1 [c.124.1.2] SUCCINYL-COA:3-KETOACID-COENZYME A TRANSFERASE(query 296->500)
    4e-04  11%  1nijA1 [c.37.1.10] HYPOTHETICAL PROTEIN YJIA A:2 -- 223(query 402->505)
    6e-05   8%  1ex6A  [c.37.1.1] GUANYLATE KINASE(query 421->500)
    1e-05  21%  1l7vC  [c.37.1.12] VITAMIN B12 TRANSPORT ATP-BINDING PROTEIN BTUD(query 425->504)
    2e-04   8%  1mukA  [e.8.1.4] MINOR CORE PROTEIN LAMBDA 3(query 340->504)
    4e-06  13%  1bgxT2 [c.120.1.2] TAQ DNA POLYMERASE T:1 -- 173(query 427->505)
    9e-08  13%  1pf4A1 [c.37.1.12] TRANSPORT ATP-BINDING PROTEIN MSBA A:321 -- 564(query 264->505)
    7e-06  11%  1t06A  [a.118.1.17] HYPOTHETICAL PROTEIN(query 350->508)
    2e-04  11%  1jjvA  [c.37.1.1] DEPHOSPHO-COA KINASE(query 421->505)
    2e-04   0%  2gx8A1 [c.135.1.1] NIF3-RELATED PROTEIN A:4 -- 373(query 479->505)
    6e-04   5%  1n25A  [c.37.1.20] LARGE T ANTIGEN(query 428->505)
    2e-04  11%  1mm8A  [c.55.3.4] TN5 TRANSPOSASE(query 346->504)
    7e-04  18%  1f2t.1 [c.37.1.12] RAD50 ABC-ATPASE A:- -- - B:- -- -(query 426->500)
    5e-04  12%  1tmkA  [c.37.1.1] THYMIDYLATE KINASE(query 481->505)
    1e-05  12%  2vgmA3 [d.79.3.2] DOM34 A:278 -- 381(query 427->504)
    8e-06  10%  2pa7A1 [b.82.1.1] DTDP-6-DEOXY-3,4-KETO-HEXULOSE ISOMERASE A:2 --(query 407->505)
    1e-06  16%  1ii8.1 [c.37.1.12] RAD50 ABC-ATPASE A:- -- - B:- -- -(query 399->505)
    2e-04  10%  1uouA3 [d.41.3.1] THYMIDINE PHOSPHORYLASE A:374 -- 480(query 477->505)
:539

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLFQGLGLTKRYGDFTANSAIDIAIAPGQIHALLGENGAG
1b0uA           ------------------------------------DLHKRYGGHEVLKGVSLQARAGDVISIIGSSGSG
1sgwA           ------------------------------------DLSVGYDK-PVLERITMTIEKGNVVNFHGPNGIG
1ji0A           ------------------------------------SLHVYYGAIHAIKGIDLKVPRGQIVTLIGANGAG
1m3eA1          --------------------------------------------YTDAVEAVKDIPNGATVLVGGFGLCG
1nijA1          --------------------------------------------------------PIAVTLLTGFLGAG
1q3hA           ------------------------------------FSHLCLVGNPVLKNINLNIEKGEMLAITGSTGSG
1ex6A           ----------------------------------------------------------RPIVISGPSGTG
1l7vC           ---------------------------------------QDVAESTRLGPLSGEVRAGEILHLVGPNGAG
1mukA           ------------------------------------ARRHSYSSFSKLLEAYLLV-----KWRMCEAREP
1khbA1          -----------------------------------------LAEHMLVLGITNPEGEKKYLAAAFPSACG
1e69A           ----------------------------------------YLKGFKSFGRPSLIGFSDRVTAIVGPNGSG
1zs3A1          ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
1e9rA           ------------------------------------RMTREKAKQVTVAGVPMPRDAEPRHLVNGATGTG
1kgdA           --------------------------------------------------------MRKTLVLLGAHGVG
1pf4A1          ------------------------------------DVTFTYKEKPALSHVSFSIPQGKTVALVGRSGSG
1ffhA2          -------------------------------------------------ARLPVLKDRNLWFLVGLQGSG
1urjA           ----------------------------------GLDPDRALLYLVVTEGFKEAVCINNTFLHLG--GSD
1t06A           -----------------------------------------------------ALGKERTKKIYISNGAH
2gk3A1          ----------------------------------------------------------------------
1jjvA           ---------------------------------------------------------TYIVGLTGGIGSG
2gx8A1          -----------------------------------------VVVFVPVTHAEEVRKALGDAGAGHIGNYS
1mjgM           -------------------------------------IKLDLPINFGPAFEGESIRKGDMYVEMGGNRTP
2yyeA2          -----------------------------------------------------GAQVGQLLILTKPIGTG
1qhlA           ------------------------------------SLTLIN--WNGFFARTFDL-DELVTTLSGGNGAG
1udwA           ---------------------------------------------------------PFLIGVSGGTASG
1e6cA           ----------------------------------------------------------EPIFMVGARGCG
1n25A           --------------------------------------------------MVYNIPKKRYWLFKGPIDSG
1jalA1          ---------------------------------------------------------GFKCGIVGLPNVG
1bmfA3          --------------------------------------REPMQTGIKAVDSLVPIGRGQRELIIGDRQTG
1f46A           ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
1d6jA           -----------------------------------------ASALTRSERTELRNQRGLTIWLTGLSASG
1t3wA           ----------------------------------------------------------------------
1xbtA1          ---------------------------------------------------------GQIQVILGPMFSG
1j1zA2          ----------------------------------------------------------------------
1f2t.1          -------------------------------------------NFRSHSDTVVEFKEG-INLIIGQNGSG
2v3jA1          --------------------------------------------------LTSKDKITKRXIVVLAXASL
1cr0A           -------------------------------LSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMG
1vplA           ------------------------------------DLRKRIGKKEILKGISFEIEEGEIFGLIGPNGAG
1tljA           -------------------------------------LVWEELREKALNKIYHDKEIGYLDPDILGFLLA
2iqhA1          --------------------------------NNGDDATAGLTHM-MIWHSNLNDATYQRTRALVRTG-M
1ohcA1          ----------------------------------------------------------------------
1fl9A           ------------------------------------FSMLRFGKKFAEILLKLHTEKAIMVYLNGDLGAG
1zp6A1          ---------------------------------------------------------GNILLLSGHPGSG
1jb1A           ---------------------------------------------RSXHGVLVDI-YGLGVLITGDSGVG
1c4oA1          ------------------------------------GPSPKGDQPKAIAGLVEALRDGERFTLLGATGTG
1tmkA           -------------------------------------------------------GRGKLILIEGLDRTG
1i1qA           ------------------------------------YVMHLVSRVVGEHDLDALHAYRACMNMGTLSGAP
1g6hA           ------------------------------------NIVKYFGEFKALDGVSISVNKGDVTLIIGPNGSG
1jbkA           --------------------------------AEQGKLDPVIGRDEERTIQVLQRRTKNNPVLIGEPGVG
1np6A           ---------------------------------------------------------IPLLAFAAWSGTG
2vgmA3          ----------------------------------------------------------------------
1l3aA           ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1pv4A3          -------------------------------------LTPLHANDLTARVLDLPIGRGQRGLIVAPPKAG
1cd5A           ------------------------------------HVVTFNMDEYVGPKEHPESYYSFMHRNFFDHVDI
1lw7A2          ---------------------------------------------------EARPFFAKTVAILGGESSG
1s9hA           -------------------------------ILELNGYDPQYAASVFLGWATKKFGKRNTIWLFGPATTG
2pa7A1          ----------------------------------------------------------------------
2axpA1          -----------------------------------------------------------LIILEGPDCCF
1ak2A1          ---------------------------------------------------------GVRAVLLGPPGAG
1g8yA           ------------------------------------NILEAFAAPPPLDYVLPNMVAGTVGALVSPGGAG
1g6oA           -------------------------------------YNLLDNKEQAISAIKDGIAIGKNVIVCGGTGSG
1qhdA1          ---------------------------------------NFDNSSEYIENWNLQNRRQRTSVLADASETM
1e3mA2          -------------------------------------VVEQVLNEPFIANPLNLSPQRRXLIITGPNXGG
2fggA1          ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1gm5A1          ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------KNIVFIGFXGSG
2ancF1          ---------------------------------------------------------GTLYIVSAPSGAG
1f8xA           ----------------------------------------------------------------------
1dnpA2          ----------------------------------------------------------------------
1grqA           ---------------------------------------------------------TRMIILNGGSSAG
2vnuD1          ------------------------------------RAAELLDKRIVSWPTTHKYPLGHFVRDLGTIESA
1bccF           ----------------------------------------------------------------------
1ii8.1          ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
1yvuA2          ----------------------------------------------------------------------
1ni3A1          -------------------------------------------------------------GIVGXPNVG
1rkbA           ------------------------------------------------------LMLLPNILLTGTPGVG
1em8A           ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1poiA           --------------------------------------------MTLKDAIAKYVHSGDHIALGGFTTDR
1ckvA           ------------------------------------GLKGKDFADQFFADENQVVHESDTVVLVLKKSDE
1afrA           --------------------------------------------------VTHSMPPQKIEIFKSLDNWA
1t9hA2          ----------------------------------------------------------------------
3cddA2          ---------------------------------------TKIGITRSLEAXSGAFDLEXTYKFLGNDAQY
1iqrA2          ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------VGFGESNFTSIIGPNGSG
1dhyA1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1l7lA           --------------------------------------------------VLANNEAGQVTSIIYNPGDV
1mi8A           ------------------------------------DLLDEKDFEIAINEQTMKLESAKV-SRVFMTGKK
1dwmA           ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------GFPGAG
1yr6A1          -----------------------------------------------------------IVVFVGTAGSG
1sbxA           ----------------------------------------------------------------------
1atrA1          --------------------------------------------------PAVGIDLGTTYSCVGVFQHG
1vhhA           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
1ovmA2          -------------------------------VIDSPDICWVGCELNASYAADGYARCKGFAALLTTFGVG
1xl3C1          ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1esmA           -------------------------------LSRLLNFYISSNAVLEQFLGTNGQRIPYIISIAGSVAVG
1jqjA3          ----------------------------------------------KFRGVRLYVSENQLKITANNPEQE
2gtlM1          ------------------------------------AHRKSFFPLRATLSYELDEHDHTVSTTQLRGFYN
1iioA           ----------------------------------------------------------------------
2gujA1          -------------------------------------------------------------------KKG
1uouA3          ----------------------------------------------------------------------
1g8fA3          ------------------------------------------------------PKQGFSIVLGNSLTVS
1a4iA2          ----------------------------------------------------------------------
1ckeA           -------------------------------------------------------AIAPVITIDGPSGAG
1b77A2          --------------------------------------------------VITEIKAEDLQQLL-----R
1pgsA2          -----------------------------------------------------TEKAYLRTTISGWGHAK
1oa8A           ----------------------------------------------------------------------
1tueA           --------------------------------------------------FLKGTPKKNCLVFCGPANTG
2je6I3          --------------------------------------------------IVIDIMPVKVPRVIGKNKSM
1jqjA2          ----------------------------------------------------------------------
1sfjA           ----------------------------------------------------------------------
1e2hA           ------------------------------------------------------MPTLLRVYIDGPHGMG
1heiB1          ------------------------------------------------SSPPAVPQSFQVAHLHAPTGSG
1odfA           -------------------------------------------------WFETGNKCPLFIFFSGPQGSG
1b0uA           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1m3eA1          ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
1ex6A           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
1pf4A1          ----------------------------------------------------------------------
1t06A           ----------------------------------------------------------------------
1jjvA           ----------------------------------------------------------------------
2gx8A1          ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
1ii8.1          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           KSTLVKTICGLIQPDDGAMRWRXXXXXXXXXXXXXXXXIGLVSQHFALFDNLTVAENVALGQRGGESLDI
1b0uA           KSTFLRCINFLEKPSEGADKDGQLKVADKNQLRLLRTRLTMVFQHFNLWSHMTVLENVMEAPILGLSKHD
1sgwA           KTTLLKTISTYLKPLKGEIIYNGVPITKVKGK------IFFLPEEIIVPRKISVEDYLKAVASLYGVKV-
1ji0A           KTTTLSAIAGLVRAQKGKIIFNGQDITNKPAHVINRXGIALVPEGRRIFPELTVYENLXXGAYNRKDKEG
1m3eA1          IPENLIGALLKTGVKELTAVSDNFGLGLLLQSKQIKRXISSYVGENAEFERQYLAGELEVELTLAERIRA
1nijA1          KTTLLRHILNEQHGYKIAVIEN-EFGEVSVDDQLIGDRATQIKTLTNGCICCSRSNELE-----DALLDL
1q3hA           KTSLLMLILGELEASEGIIKHSGRVSFCSQFSWIMPGTIKENIIFGVSYDEYRYKSVVKACQLQQD----
1ex6A           KSTLLKKLFAEYPDSFGFSVSSTTRTPRAGEVNG----KDYNFVSVDEFKSMIKNNEFIEWAQSGNYYGS
1l7vC           KSTLLARXAGXT-SGKGSIQFAGQPLEAWSATKLALH-RAYLSQQQTPPFATPVWHYLTLHQHDKTRTEL
1mukA           SVDLRLPLCAGIDPLNSDPFLKMVSVGPMLQSTRKY--FAQTLFMAKTVSGLNAIDSALLRLRTLGADK-
1khbA1          KTNLAMMNPSLPGWKVECVGDDIAWMKFDAQGHLRAINP--ENGFFGVAPGTSVKTNPNAIKTIQKNTIF
1e69A           KSNIIDAIKWVFGEKFDMI-FAGSENLPPAGSAYVELVFEENGEEITVAIDRIVNAYQRVNESFNRFISL
1zs3A1          --------------------------------------KAEIDHHKPTAGAMLVLSNLFIENTQAGIYAK
1bgxT2          ----MRGMLPLFEPKGRVLLVDG---------------HHLAYRTFHALKGLTTSRGEPVQAVYGKALKE
1e9rA           KSVLLRELAYTGLLRGDRMVIVDPNGDMLSKFGRD---KDIILNPYDQRTKGWSFFNEIRNDYWQRYALS
1kgdA           RRHIKNTLITKHPDRFAYPIPHTTRPPEENGKNYYFVSHDQMMQDISNNEYLEYGSHEDAMYG-------
1pf4A1          KSTIANLFTRFYDVDSGSICLD-GHDVRDYKLTNLRRHFALVSQNVHLFNDTIANNIAYAAEGEYTREQI
1ffhA2          KTTTAAKLALYYKGKGRRPLLV-----------------AADTQRPAAREQLRLLGEKVGVPVLEVMDGE
1urjA           KVTIGGAEVHRIPVYPLQLFMFSRVIAEPFNANHRSIGEKFTYPLPFFNRFEAVVGPAAVALRSRN-VDA
1t06A           EPVFGVATGAMKPIAKK---IKLNQELAEELYATGNYDAMYFAGIIADPKAMSE-SDFDRWIDGAYFYML
2gk3A1          --------------------------------------LKVLFIGESWHIHXIHSKGYDSFTSS--KYEE
1jjvA           KTTIANLFTDLGVPLVDA---DVVAREVVAKDSPLLSKIVEHFGAQILNRAALRERVFNHDED-------
2gx8A1          HCTFSSEGTGTFVPQQLERVEEVRIETIIPASLQRKVIVTAHPYEEVAYDVYPLDNKGETLGLG--KIGY
1mjgM           AFELVRTVSESEITDGKIEVIG---PDIDQIPEGSKLPLGILVDIYGRKMQADFEGVLERRIHDFINYGE
2yyeA2          ILIKGLKEGILKEEDINEAIENMLALNDKARNLMLSLDATACTDVTGHAWNICKNSNIGARIFEKVPYYQ
1qhlA           KSTTMAAFVTALIPDLTLLLGVCYSMLDTINSRHQRVVVGVLQQVAGRDRKVDIKPFAIQGLPMVQPTQL
1udwA           KSSVCAKIVQLLQKQVVILSQDSFYRVLTSEQKAKALKGQFNFDHPDAFDNELILKTLKEITE-------
1e6cA           MTTVGRELARALGYEFVDTDIQHTSGMTVADVVAAEGWPGFRRRESEALQAVATPNRVVATGGGMVLLEQ
1n25A           KTTLAAALLELCGGKALNVNLPLDRLNFELGVAIDQFLVVFVKGTGGESRDLDNLRDYLDGSVKVNLEKK
1jalA1          KSTLFNALTKAGPFCTIEPNTGVVPMPDPRLDALAEIVKPERILPTTMEFVDIAGLVAGASKGEGLGNKF
1bmfA3          KTSIAIDTIINQKRFNDGTDEKKKLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQY
1f46A           --IIMNVAAHHGSELNGELLLNSIQQ------------AGFIFGDMNIYHRHLSPDGSGPALFSLANMVK
1es6A2          ----------------------------------------------ALRPGISFHPKLRPILLPNKNSAD
1mm8A           -----------------------------------------VFSSAALGDPRLVNVAAQLAKYSGKSITI
1d6jA           KSTLAVELEHQLVRDRRVHAYRLDGDNIRFGLN---------KDLGFSEADRNENIRRIAEVAKLFADSN
1t3wA           KRTTXRILIGLLNPELATLVPPLENLDENK--------LPGLGLFRELVNTCLSQPGLTTGQLLEHYRGT
1xbtA1          KSTELMRRVRRFQIAQYKCLVIKYAKDTRALPACLLRDVAQEALGVAVIGIDEGQFFPDIVEF-------
1j1zA2          --------------------------------------ANLLHISYEGGVLEDPWAEPPK---GMFRMTQ
1f2t.1          KSSLLDAILGLYWP--------------------------------------------------GKYSEV
2v3jA1          ETHKIYVLLNCDDHQGLLKKXGRDISEARPDITHQCLLTLLDSPINKAGKLQVYIQTSRGILIEVNPTVR
1cr0A           KSTFVRQQALQWGTAMG---KKVGLAMLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDE
1vplA           KTTTLRIISTLIKPSSGIVTVFGKNVVEEPHEVRKLISYLPEEAGAYRNMQGIEYLRFVAGFYASSSSEI
1tljA           FYRNRNDVYTQSSCSGRITIVDAEMPWDRKNSTIIFKNHLRITEQDLEDVLSKNQVRRLWLIVQGPIIHI
2iqhA1          DPRMCSLMQGSTLPRRSGAAG-AAVKGVGTMVMELIRMIKRGINRRTRIAYERMCNILKGKFQTAAQRTM
1ohcA1          --------------------------------------SNVHYFSINELEYENFYADFGPLNLA-----M
1fl9A           KTTLTRGMLQGIGHQGNVKSP-------TYTLVEEYNIAGKMIYHFDLYRLADPEELEFMGNTDSICLIE
1zp6A1          KSTIAEALANLPGVPKVHFHSDDLWGYIKHGRIDPW-----LPQSHQQNRXIXQIAADVAGRYAKEGYFV
1jb1A           KSETALELVQRGHRLIADDRVDVYQQDEQTIVGA----APPILSHLLEIRGLGIIDVXNLFGAGAVTISL
1c4oA1          KTVTMAKVIEALGRPALVLAPN------------KILAAQLAAEFRELFPENAVEYFISYYDYYQPEAYV
1tmkA           KTTQCNILYKKLQPNCKLLKFPERSTRIGGLINEYLTDDSFQLSDQAIHLLFSANRWEIVDKIKKD----
1i1qA           KVRAMQLIADAEGQRRGSYGGA----------------VGYFTAHGDLDTCIVIRSALVENGI------A
1g6hA           KSTLINVITGFLKADEGRVYFENKDITNKEPAELYHYGIVRTFQTPQPLKEMTVLENLLIGEIWIPKEEE
1jbkA           KTAIVEGLAQRIINGEVPEGLKGRRVLALDMGALVAGAKYREERLKGVLNDLAKQEGNVILFIDELHTMV
1np6A           KTTLLKKLIPALCARGIRPGLIKHTHH----------------ELRKAGAAQTIVASQQRWALMTETPDE
2vgmA3          ----------------------------------------------------------------------
1l3aA           --------------------------------------SPLDSGAFKLSREGMVMLQFAPAQYDWSRKQV
2f9hA1          --------------------------------------AIDDSEKXIILFGETATDTLKQHAVIQSFPEK
1pv4A3          KTXLLQNIAQSIAYNHPDCVLXVLLIDERPEEVTEXQRLVKGEVVASTF-DEPASRHVQVAEXVIEKAKR
1cd5A           PAENINLLNGNAPDIDAECRQYEEKIRSYGKIHLFMGGVGNDGHRIKTLTHDTRVANSRFFDNDVNQVPK
1lw7A2          KSVLVNKLAAVFNTTSAWEYGR-----------------EFVFEKLGGDEQAMQYSDYPQXALGHQRYID
1s9hA           KTNIAEAIAHTVPFYGC----VNWTNENFPFNDCVDKMVIWWEEGKMTAKVVESAKAILGGSK--VRVDQ
2pa7A1          ----------------------------------------------------------------------
2axpA1          KSTVAAKLSKELKYPIIKGSSAKSGNEKLFEHFNKLADEDNVIIDRFVYSNLVYAKKFKDYSILTERQLR
1ak2A1          KGTQAPKLAKNFCVCGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVLELIEKNLETPPCKNGFLLDGF
1g8yA           KSMLALQLAAQIAGGPDLLEVG--------------ELPTGPVIYLPAEDPPTAIHHRLHALGAHLSAEE
1g6oA           KTTYIKSIXEFIPKEERIISI----EDTEEIVFKHHKNYTQLFFGGNITSADCLKSCLRXRPD---RIIL
1qhdA1          LANVTS-VRQEYAIPVGPVFPP---GMNWTDLITNYSPSREDNLQRVFT-VASIRSML------------
1e3mA2          KSTYXRQTALIALXAYIGSYVP-AQKVEIGPIDRIFTRVGFXVEXTETANILHNATEYSLVLXDEIGRGT
2fggA1          ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1gm5A1          ---------------------------------------------SSLFLWGEALPTLLEELNEVEKMLK
1viaA           KSTLARALAKDLDLVDSDFLIEQKFNQKVSEIFEQKRENFFREQEQKXADFFSSCEKACIATEKAGFCIY
2ancF1          KSSLIQALLKTQPLYDTQEAIEQVLATGVDVFLDIDWQGAQQIRQKMPHARSIFILPPSKQDSEEVIAKR
1f8xA           ----------------------------------------------------------------------
1dnpA2          ---------------------------------------------VWFRQDLRLHDNLALAAA-------
1grqA           KSGIVRCLQSVLPEPWLAFGVD-SLIEAMPLKMQSAEGGIEFDADGGVSIGPEFRALEGAWAEGVV----
2vnuD1          QAETEALLLEHDVEY-------------------------------------------------------
1bccF           --------------------------------------NAAGFNKYGLMRDDTIYENDDVKAIRRLPENL
1ii8.1          -------------------------------------------REAALSKIGELASEIFAEFTEGKYSEV
1bs2A1          ----------------------------------------------------------------------
1yvuA2          --------------------------------------KXIPSQVILNRNLKFVLLNVAEQVKTGNIPYK
1ni3A1          KSTFFRAITKSVLGNPANYPYATIDPEEAKVAVPDERFDEAYKPKSRVPAFLTVFDIAGLTKGASTGVGL
1rkbA           KTTLGKELASKSGLKYINV---GDLAREEQLYDGYDEEYDCPILDEDRVVDELDNQMREGGVIVDYHGCD
1em8A           ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1poiA           KPYA--AVFEILRQGITDLTGLGGAAGGDWDMLIGNGRNCYTANSGVTNVSRRFRKWFEAGKLTMEDYSQ
1ckvA           INTFIEEILLTDYKKNVGYWWIKANGKIEVDCDEISELLGRQFNVYDFLVDVSS-TIGRAYTLGNK----
1afrA           EENILVHLKPVEKCWQPQDFL-------------------------------------------------
1t9hA2          --------------------------------------LGYTFPDIREKSSSCKFRGCLHLKEPKC----
3cddA2          KAFIEPIKQGQACTVDIGGERVITGYVDDWVPSYDESTITISVSGRDKTADLVDCSIGQFNNQTLTQIAD
1iqrA2          ----------------------------------------------------------------GPLLVW
1w1wA           KSNMMDAISAFYQKGNKLVELMRIISRNGDTSYKIDGKTVSYKDYSIFLENLIKAKNFLVFQGVSDHLDA
1dhyA1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------ASKTKAGVSLI-
1l7lA           ITIVAAGWASYGPTQKWGPQG------DREHPDQGLICHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNN
1mi8A           LVYILKTRLGRTIKATANHRF-LTIDGWKRLDELSLKEHIALPRKSDISWDSIVSITETGVEE-------
1dwmA           ----------------------------------------------------------------------
1yj5A2          KSTFIQEHLVSAGYVHVNRDTLGSWQRCVSSCQAALRQGKRVVIDNTNPDVPSRARYIQCAKDAGVPNFC
1yr6A1          KTTLTGEFGRYLEDNYKVAYVNLDTGVKELPYEPSIDVREFVTVEEIMREGYGPNGAIVESDRLMEKFNE
1sbxA           ----------------------------------------------------------------------
1atrA1          KVEIIANDQGNRTTPSYVAFT-------------------------------------------------
1vhhA           ----------------------------------------------------------------------
1d8jA           --------------------------------------------------SGSSGYKFGVLAKIVNYMK-
1ovmA2          ELSAMNGIAGSYAEHVPVLHIVGAPGTAAQQRGEL---LHHTLGDGEFRHFYHMSEPITVAQAEQNACYE
1xl3C1          ----------------------------------------------AYDLSEFMGDIVALVDXRWAGIHD
1g31A           ----------------------------------------------------------------------
1esmA           KSTTARVLQALLSRWPEHRRVE--------------------LITTDGFLHPNQVLKERGLXKKKGFPES
1jqjA3          EA--EEILDVTYSGAEMEIGFN---------VSYVLDVLNALKCENVRM-MLTDSVSSVQIE--------
2gtlM1          FGKRELLLAPLKGQSEGYGVIFNLGDDDHADCKIVVPSSLFVCAHFNAQ---------------------
1iioA           ------------------------------------------------------GSHMKMGVKEDQIIGA
2gujA1          SDPYFTLQAVLDDQSSGRGTERDVNFDSAKIASLDEEEVPFTFEDFDVPEKL------------------
1uouA3          ----------------------------------------------------------------------
1g8fA3          REQLSIALLSTFLQFGGGRYYK-------IFEHNNKTELLSLIQDFIGSGSGLIIPDQWEDDK----DSV
1a4iA2          ----------------------------------------------------------------------
1ckeA           KGTLCKAMAQWHLLDSGAIY-----RVLALAALHHHVDVASEDALVPLASHLDVRVSTNGNLEVILEGED
1b77A2          VSRGLQIDTIAITNKDGKIVINGYNKVEDSGLTRPKYSLTLTDYDGNNFNFVINMANMKIQPGYKVMLWG
1pgsA2          PYDAGSRGCAEWCFRTHTIAI-NNANTFQHQLGALGCSANPINNQSPGN---WTPDRAGWCPGMAVPTRI
1oa8A           -----------------------------------------------YFMKGSIIQLANGELKKVEDLKT
1tueA           KSYFGMSFIHFIQGAVI-----------------------------------------------------
2je6I3          YETL--TSKSIFVANNGRIWA-------------------------------------------------
1jqjA2          -------------------------------------------------------SEVEFTLPQATMKRL
1sfjA           --------------------------------------------------------------------NV
1e2hA           KTTTTQLLRDDIVYVPE-----------------------------------------------------
1heiB1          KSTKVPAAYAAQGYKVLVL---------------------------------------------------
1odfA           KSFTSIQIYNHLMEKYGGEKSI--------------GYASIDDFYLTHEDQLKLNNNKLLQGRGLPGTHD
1b0uA           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1m3eA1          ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
1ex6A           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
1pf4A1          ----------------------------------------------------------------------
1t06A           ----------------------------------------------------------------------
1jjvA           ----------------------------------------------------------------------
2gx8A1          ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
1ii8.1          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LSRRLAQIAERYGLPLDPKREVWRLSVGERQRIEIVRALMQDPQFLILDEPTAVLTPAEADRLFDVLEQL
1b0uA           ARERALKYLAKVGIDERQGKYPVHLSGGQQQRVSIARALAMEPDVLLFDEPTSALDPELVGEVLRIMQQL
1sgwA           -NKNEIMDALESVEVLDLKKKLGELSQGTIRRVQLASTLLVNAEIYVLDDPVVAIDEDSKHKVLKSILEI
1ji0A           IKRDLEWIFSLFPRLKERLKQLGTLSGGEQQXLAIGRALXSRPKLLXXDEPSLGLAPILVSEVFEVIQKI
1m3eA1          GGAGVPAFYTSTGYGTLVQEGGSPIKYNKDGSIAIASKPREVREFNGQHFILEEAIRGDFALVKAWKAD-
1nijA1          LDNKGNIQFDRLVIECTGMADPGPIIQTFFSHEVLCQRYLLDGVIALVDAVHADEQM---NQFTIAQSQV
1q3hA           ------ITKFAEQDNTVLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCK
1ex6A           TVASVKQVSKSGKTCILDIDMQGVKSVKAIPELNARFLFIAPPSVEDLKKRLEGRGTETEESINKRLSAA
1l7vC           LND----VAGALALDDKLGRSTNQLSGGEWQRVRLAAVVLQAGQLLLLDEPXNSLDVAQQSALDKILSAL
1mukA           --KALTAQLLMVGLQESEADALAGIMLQDVNTVQLARVVNLAVPDTWMSLDFDSMFKHHVKLLPKDGRHL
1khbA1          TNVAETSDGGVYDEPLASGVTITSWKNKEWSSEDGEPCAHPNSRFCTPASQCPIIDAAWESPEGVPIEGI
1e69A           LFFGGEGRLISIRKPGRRDQKLSLLSGGEKALVGLALLFAKPSPFYVLDEVDSPLDDYNAERFKRLLKEN
1zs3A1          SPVKCEYLREIAQREVEYFFKISDLLLDENEIVPSTTEEFLKYHKFITEDPKAKYWTDE-DLLESFIVDF
1bgxT2          DGDAVIVVFDAKAPSFRHEAYGGYKAGRAPTPEDFPRQLALIKEVDLLGLARLEVPGYEADDVLASLAKK
1e9rA           VVPRGKTDEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEA
1kgdA           -TKLETIRKIHEQGLIAILDVEPQALKVLRTAEFAPFVVFIAAPTITPGLNEDESLQRLQKESDILQRT-
1pf4A1          EQAARQAHAMPQGLDTVIGENGTSLSGGQRQRVAIARALLRDAPVLILDEATSALDTESERAIQAALDE-
1ffhA2          SPESIRRRVEEKARLEARDLILVDTAGRLQIDEPLMGELARLKEVLGPDEVLLVLDAMTGQEALSVARAF
1urjA           VARAAAHLAENHEGAALPADITFTGGFEQRLASVMAGDAALASMAVFDEPPTDISAWPLFEGQDTAAARA
1t06A           SDYVVAVTLSESNIAQDVADKWIASGDELKMSAGWSWLLGNRKDNAFSESKISDMLEMVKDTIHHSPERT
2gk3A1          GATWLLECLRKGGVDIDYIAFPESIDELNRYDVIVISDIGSNTFLLQNETFYQLKIKP---NALESIKEY
1jjvA           -----KLWLNNLLHPAIRERMKQKLAEQTAPYTLFVVPLLIENKLTALCDRILVVDVSPQTQLAR--SAN
2gx8A1          LQEEMTLGQFAEHVKQSLDVKGARVVGKLDDKVRKVAVLGGDGNKYINQAKFKGADVYVTGDMYYHVAHD
1mjgM           GLWHTGQRNINWLRVSKDAVAKGF-RFKNYGEILVAKMKEEFPAIVDRVQVTIFTDEAKVKEYMEVAREK
2yyeA2          LSENLVKKKIYPKGAIENLNFVKLKSNLDNWKLILLSDPVTSGGLLFTINKEK------LEKIDETAKEL
1qhlA           VTETLNERQARVLPLNELKDKLEAMTDYHSLMFDLLRSASDRSKFYRLIEASLYISSAITRSLRDYL---
1udwA           --GKTVQIPVYDFVSHSRKEETVTVYPADVVLFEGILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDI
1e6cA           NRQFMRAHGTVVYLFAPAEELALRLQATGRPIAEEMEAVLREREALYQDVAHYVVDATQPPAVCELMQTM
1n25A           HLNKRTQIFPPGIVTMNEYSVPKTLQARFVKQIDFRPKDYLKHCLERSEFLLEKRIIQGIALLLMLIWYR
1jalA1          LANIRETDAIGHVVRCFENIDPLDDIDTINTELALADLDSCERAIQRLQKRAKGGDKEAKFELSVMEILP
1bmfA3          LAPYSGCSMGEYKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDAFGGG
1f46A           PGTFDPEMKDFTTPGVTIFPSYGDELQLFKLMLQSAQHIADEVGGVVLDDQRRMMTPQKLREYQDIIREV
1es6A2          LTSAIMTSLQDFKI--VPIDPTKNIMGIEVPETLVLKLTGGQPIIPVLLPKYIGLDPVAPGDLTMVITQD
1mm8A           SSEGSKAAQEGRFIRNPNVSAEAIRKAGAMQTVKL----AQEFPELLAIEDTTSLSY-RHQVAEELGKLG
1d6jA           SIAITSFISPYRKDRDTARQLHEVATPGEETGLPFVEVYVDVPVEAPYEAPANPEVHVKNYELKQIIDYL
1t3wA           NNAATLEKLSXWDD--IADKNIAEQTFTDSLNHXFDSLLELRQEELIARERTHGLSNEERLELWTLNQEL
1xbtA1          -CEAMANAGKTVIVAALDGTFQRKPFGAILNLVPLAESVVKL----------------------------
1j1zA2          DPEEAPDAPEYVEVE-FFEGDPVAVNGERLSPAAL----LQRLNEIGGRHGVGRVDIVENRFVGMKSRGV
1f2t.1          VVRAEENKVRLFVVWEGKERPLTFLSGGERFRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERY
2v3jA1          IPRTFKRFSGLXVQLLHKLSIRSEEKLLKVIKNPITDHLPTKCRKVTLSFDAPVIRVQDYIEK-----LD
1cr0A           L------------FGNDTFHLYDSFAEAETDRLLAKLAYMLGCDVIILDHISIRKMIDNLMTKL--KGFA
1vplA           -EEMVERATEIAGLGEKIKDRVSTYSKGMVRKLLIARALMVNPRLAILDEPTSGLDVLNAREVRKILKQA
1tljA           YAKNIETGWDILKIAREAGFKHSGILATNQKGVLVELRTGIRMVHLLRESNTERVDKDKIKTLVNVCNEV
2iqhA1          VDQVRESRNPGNAEFEDLIFLARSLRGSVAHKSCLPACVYGSAVASGYDFEREGYSLVGIDPFRLL----
1ohcA1          VYRYCCKINKKLKSIMLRKKIVHFTGSDQRKQANAAFLVGCYMVIYLGRTPEEAYRILIFGETSYIPFRD
1fl9A           WSEKGQGILPEADILVNDDARNIELIAQTNLGKNIISAF-------------------------------
1zp6A1          ILDGVVRPDWLPRPLHYIVLRTTAAEAIERCLDRGGDSLSDPLVVADLHSQFADLGAFEHHVLPVSGKDT
1jb1A           IVHLENWTPDQLIFDVPVPKITVPVKVGRNLAIIIEVAAXNFRAKSXGYDATKTFEKNLNHLI-------
1c4oA1          PGKSINPEIERLSLLTRRDVIVVASVSAIYGLGDPREYRARNLVGFVLFPATHYLSPEGLEEILKEIEKE
1tmkA           LLEGKNIVMDRYVYSGVAYSAAKGTNGMDLDWCLQPDVGLLKPDLTLFLSTQFGDERYETVKFQ------
1i1qA           TVQAGAGIVLDS-VPQSEADETRNKARAVLRAIATAH---------------------------------
1g6hA           MVEKAFKILEFLKLSHLYDRKAGELSGGQMKLVEIGRALMTNPKMIVMDEPIAGVAPGLAHDIFNHVLEL
1jbkA           GAMDAGNMLKPALARGELHCVGATTLDEYRQYIEKDAALERRFQKVFVAEPSVEDTIA------------
1np6A           EELDLQFLASRMDTSKLDLILVEGFKHEEIAKIVLFRDGAGHRPEELVIDRHVIAVASPLNLDVALLDIN
2vgmA3          ------------------------KAWYGEKEVVKAAEYGAISYLLLTDKVLHSDNIAQREEYLKLMDSV
1l3aA           FSLSVTEIGSIISLGTKDCEFFHDPNKGRSDEGRVRKVLKVEP---LPDGSGHFFNLSVQNKLINLDENI
2f9hA1          DQVTLAEGDHLKIGDTNTITKVGSFANSNLQSIAHSTLIFADAPTDEDDVIRN------GVYLTPHQLPK
1pv4A3          LVEHKKDVIILLD---------SITRLARAYNTVVPAVLTGGVDANALHRPKRFF-----GAARNVEEGG
1cd5A           YALTVGVGTLLDAESQKALALQAAVEGCVNHMWTISCLQLHPKAIMVCDEPSTMELKVKTLRYFNELEAE
1lw7A2          YAVRHSHKIAFIDTDFITTQAFCIQYEGKAHPFLDSXIKEYPFDVTILLKNN---TEQKQRQQFQQLLKK
1s9hA           KCKSSAQIDPT-PVIVTSNTNMCAVIDGNSTTFEHQQPLQDRMFKFELTRRLDHDFG-------------
2pa7A1          -------TKGEEPRGFHAHKKLEQVLVCLNGSCRVILDDGNIIQEITLDSPAVGLYVGP--AVWHEMHDF
2axpA1          FIEDKIKAKAKVIKKRLRVRGDEYIEGKDIDILELYREVXSNAGLHTYSWDTGQWSSDEAKDIIFLVE--
1ak2A1          PRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRITGRLIHSDDNKKALKIRLEAYHTQTTPLVEYY
1g8yA           RQAVADGLLIQPLIGSLPNIMAPEWFDGLKRAAEGRRLMVLDTLRRFHIEEENASGPMAQVIGRMEAIAA
1g6oA           GELRSSEAYDFYNVLCSGHKGTLTTLHAGSSEEAFIRLANXSKFESLIEGFKDLIVHINHHKQCDEFY--
1qhdA1          ----------------------------------------------------------------------
1e3mA2          STYDGLSLAWACAENLANKIKALTLFATHYFEL---TQLPEKXEGVANVHLDALEHGDTIAFXHSVQDGA
2fggA1          --GKTCQIDVLIEEHDERTRAKARLSWAGRQXVGVGLARLDPA-----DEPVAQI-----GDELAIARAL
2qgmA1          --SVQKNIVK--SIQSQANPLKTIEPSKPFEDLKPLKKXIGNAQYVGLGENTHGSSEIFTXKFRLVKYLV
1gm5A1          NQVNTRRIHQLLKELDDPLLENKDLEEKLQAFLDYVKEIPN------LPEARKRYRIQKSLEMIEKLRSW
1viaA           LKADFEYLKKRLDKDEISKRPLFYDEIKAKKLYNERLSKYEQKANFILNIENKNIDEL-LSEIKKVIK--
2ancF1          MAQAVAEMSHYAEYDYLIVNDDFDTALTDLKTIIRAERLRMSRQKQRHDALISKLL--------------
1f8xA           -----------------PKKTIYWFTDRQNKAYKEAMEALKENPTIDLENSYVPLDNQYKGIRVDEHPEY
1dnpA2          ---CRNSSARVLALYIATPRQWATHNMSPRQAELINAQNGLQIALAEKGIPLLFREVDDFVASVEIVQVC
1grqA           --AMARAGARIIIDDVFLGGAAAQERWRSFVGDLDVLWVGVRCDGAVAEGRETARGDRVAGMAAKQAYVV
2vnuD1          ----------------------------------------------------------------------
1bccF           YDDRMFRIKRALDLNMRQQI---LPKEQWTKYEEDVPYLEPYLKEVI-----------------------
1ii8.1          VVRAEENKVRLFVVWEGKERPLTFIALGLAFRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERY
1bs2A1          -------------------YAHSRLRSVERNASGITQEKWINADFSLLKEPAAKLLIRLLGQYPDVLRNA
1yvuA2          LKEIEGKVDAFVGI------DISRITRDGKTVNAVAFTKIFNSKGELVRYYLTSYPAFGEKLTEKAIGD-
1ni3A1          GNAFLSHVRAVDAI----YQVVRAFDDAEIIHVEGDVDPIRD--LSIIVDELLIKDAEFVEKHLEGLRKI
1rkbA           FFPERWFHIVFVLRTDTNTRGYNEKKLTDNIQCEIFQVLYEEATASYKEEIVHQLPSNKPEELENNVDQI
1em8A           ---------------------------------------MKNATFYLLDNDTTVDGLSAVEQLVCEIAER
1o7d.2          ------------------------YNPLGRKVDWMVRLPVSKHVYLVKDPGGKIVPSDVVTIPSSDSQEL
1v47A1          ------------------------------PALEIGEDERLDLE-NLATGAFFPVKGFMTREEALSVAHE
1poiA           DVIYMMWHAAALGLPFLPVTLMQISKEVRKTLDKVPDDKFKYIDNPFKPGEKVVAVP-------------
1ckvA           --FTITSELMGLDRKL------------------------------------------------------
1afrA           ------------------------------------TFISHGNTARQAKEHGDIKLAQICGTIA------
1t9hA2          ---AVKQAVEDGELKQYRYDHYVEFMTEIKDR--------------------------------------
3cddA2          IVCKPFGIKVIVNTDVGEPFQRIQIEQGETPHELLARLAK-QRGVLLTSDTFGNLVIT------------
1iqrA2          HRGALLEALARGPVVGLVVLDPNNLKTTPRRRAWFLENVRA------LREAYRARGGALWVLEGLPWEAA
1w1wA           IYRELTGNASLTKYHATPPLKRFKLSGGEKTVAAL--ALLQPSPFFVLDEVDAALDITNVQRIAAYIRRH
1dhyA1          --YLGFAVKDVPAWDHFLTKSVGLMAAGSAGDAALYRADQRAWRIAVQPGELDDLAYAEVDDAAALERMA
3cddA1          ---LGDNVKAARGRFSWRQRFSKFTIKAAKADVTDSEIGRYRPLIIVNEEVTAEGAAKRGQWERQRSIGK
1l7lA           VQGAITLIY------NDVPGTYGNNSGSFSVNIGKDQS--------------------------------
1mi8A           ----------------------------------------------------------------------
1dwmA           -----------------------------------------------------ELVGKSGNMAAATVERE
1yj5A2          ATIEQARHNNRFREXTDPSHAPVSDXVXFSYRKQFEPPTLAEGFLEILEIPFRLQEHLD-PALQRLYRQF
1yr6A1          YLNKILRLEKENDYVLIDTPGQMETFLFHEFGVRLMENLPYPLVVYISDPEILKKPNDYCFVRFFALLID
1sbxA           -----------------HXFXPSDRSTERCETVTISCFVVGGEKRLCLPQILNS--VLRDFSLQQINAVC
1atrA1          ----------------------------QRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDK--------
1vhhA           --QFIPNVAEK-TLGASGRYEGKITRNSERFKELTP---NYNPDIIFKDEENTGADRLMTQRCKDKLNAV
1d8jA           --TRHQRGDTHPLTLDEILDETQHLDIGLKQKQWLTEALVNNPKIEVIDGKYAFKPK-------------
1ovmA2          IDRVLTTMLRERRP--------------------------------------------------------
1xl3C1          IEHSLPTPEIXVRFYQDLRLFPLGVFSDEEQRQNLLQMCQNAIDMAIESE--------------------
1g31A           ------------------------------------PIRAVGEYVILVSEPAQAGDEEVTESGLIIGKRQ
1esmA           YDXHRLVKFVSDLKSGVPNVTAPVYSHLIYDVIPDGDKTVVQPDILILEGLNVLQSGXDYPHDPHHVFVS
1jqjA3          ----------------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
1iioA           LAGADFPINSPEGPDTTCKSGDVELKASDAGQVLTADDFPKSAEEVADTIVNK-----------------
2gujA1          ----------------------------------------------------------------------
1uouA3          --------------------------------------------------------REQEELLAPADGTV
1g8fA3          VGKQNVYLLDTSSSADIQLESADEPISHIVQKVVLFLEDNGFFVF-------------------------
1a4iA2          ------------------------------------------PAEILNGKEISAQIRARLKNQVT--QLK
1ckeA           VSGEIRTQEVANAASQVAAFPRVREALLRRQRALIADGRDMGTVVFPDAPVKIFLDASSEERAHRRMLQL
1b77A2          AGDKVAAKFESSQVS-------------------------------------------------------
1pgsA2          DVLNNSLTGSTFS---------------------------------------------------------
1oa8A           EDFIQSAEISRIEDSHSPGVAVIQFAVGEHRAQVSVEVLVEYP-FFVFGQGWSSCCPERTSQLFDLPCSK
1tueA           ----------------------------------------------------------------------
2je6I3          ----------------------------------------------------------------------
1jqjA2          IEAQFSMAHQDVGMLFETEGEELRTVATDGHRLAVCSMPIGQS----LPSHSVIVPRKGVIELMRMLDGG
1sfjA           TVDQVAEMITKLSFKLRTKLQGGYGQFTNDSYLNLISDLANINGIDMIDIEWQ--ADIDIEKHQRIITHL
1e2hA           ----------------------------------------------------------------------
1heiB1          ----------------------------------------------------------------------
1odfA           MKLLQEVLNTFNQDTVVLPKYDKSQFKGEGDRCPTGQKIKLPVDIFILEGWFLGFNPILQGIMVDVNAKL
1b0uA           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1m3eA1          ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
1ex6A           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
1pf4A1          ----------------------------------------------------------------------
1t06A           ----------------------------------------------------------------------
1jjvA           ----------------------------------------------------------------------
2gx8A1          ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
1ii8.1          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           RADGRALLYISHKLEEVKRLCDTATILRAGRVVAACNPRAETAASLARMMVGVDVIPPKPQPGHSIGAPR
1b0uA           AEEGKTMVVVTHEMGFARHVSSHVIFLHQGKIEEEGDP--------------------------------
1sgwA           LKEGIVIISSREELS----YCDVNENLHKY----------------------------------------
1ji0A           NQEGTTILLVEQNALGALKVAHYGYVLETGQIVL------------------------------------
1m3eA1          QAGNVTFRKSARNFNLPXCKAAETTVVEVEEIVDIGSFAPEDIH-IPKIYVHRLVKGEKY----------
1nijA1          GYADRILLTKTDVAGEAEKLHERLARINARAPVYTVTHGDIDLGLLFNTN--------------------
1q3hA           LMANKTRILVTS-KMEHLRKADKILILHQGSSYFYGTFSESLRPDFSSKLMGYDTFDQFTE---------
1ex6A           QAEAHDKVIVNDDLDKAYKELKDFIFA-------------------------------------------
1l7vC           CQQGLAIVXSSHDLNHTLRHAHRAWLLKGGKXLA------------------------------------
1mukA           ---------NTDIPPRMGWLRAILRFLGAGMVMTATGVAVDIY---------------------------
1khbA1          IFGGRRPAGVPLVYEAL--SWQHGVFVGAAMRSEAKII--------------------------------
1e69A           -SKHTQFIVITHNKIVM-EAAD------------------------------------------------
1zs3A1          QAQN---MFITRAIKLANKEEKFAL---AAGVVE------------------------------------
1bgxT2          EKEGYEVRILTADKDLYQLLSDRIHVLHPEGYLI------------------------------------
1e9rA           SKATSARFVLSDKLPEHVTMPDGDFSIRSW----------------------------------------
1kgdA           YAHYFDLTIINNEIDETIRHLE------------------------------------------------
1pf4A1          LQKNKTVLVIAHR-LSTIEQADEILVVDEGEIIERGRH--------------------------------
1ffhA2          DEKGVTGLVLTKLDGDARGGAALSARHVTGKPIYFAGLEPFYPERLAGRILG------------------
1urjA           NLARAAGLVGAMVFSTNSALHL------------------------------------------------
1t06A           KSANNFLNTVVPLHEKAVEIAKEVGIVEVKRDNKKS----------------------------------
2gk3A1          VKNGGGLLXIGGYLSXGIEAKANYKNTVLAEVL-------------------------------------
1jjvA           FEQIQRIMNSQVSQQERLKWADDVINNDAELAQNLPHLQ-------------------------------
2gx8A1          MMLGLNIVDPGHNVEKKQGVQKQLQEKVDAKKLNVHIHASQ-----------------------------
1mjgM           YKDDRMRGLTDETVDTFYVLCNHVCIVTPERVGL------------------------------------
2yyeA2          EVNYWIIGETIAENVLE-----------------------------------------------------
1qhlA           ----------------------------------------------------------------------
1udwA           SERGRDLEQILSQYITFVKPAFEEFCLYADVIIPRGADNLVAINLIVQ----------------------
1e6cA           R---------------------------------------------------------------------
1n25A           PVAEFAQSIQSRIVEWKERLDKEFSLSVYQKMK-------------------------------------
1jalA1          VLENAGMIRSVGLDKEELQAIKSYNFLTLKPTMYIANV--------------------------------
1bmfA3          SLTA-LPVIETQAGDVSAYIPTNVISITDGQIFLEIRPAINVGLSVSRVG--------------------
1f46A           KDAN------------------------------------------------------------------
1es6A2          CDTCHS----------------------------------------------------------------
1mm8A           SIQDKSRGWWVHSVLLLEATTFRTVGLLHQEWWMRPDDP-------------------------------
1d6jA           DTKG---YLPAKK---------------------------------------------------------
1t3wA           A---------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1j1zA2          YETPGTILYHARRAVESLTLDREVLHQRDMLSPKYAEL--------------------------------
1f2t.1          LKKIPQVILVSHD-EELKDAAD------------------------------------------------
2v3jA1          DDESICVFVGAXARGKDNFADEYVDKVGLSNPLSASVACSKFCHGAEDAW--------------------
1cr0A           KSTGVVLVVICHDLRALRQLSDTIIALERNQLV-------------------------------------
1vplA           SQEGLTILVSSHNMLEVEFLCDRIALIHNGTIVETGTV--------------------------------
1tljA           LARGKQKMNLLK----------------------------------------------------------
2iqhA1          --QNSQVYSLIRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGTKVVPRGKLGVQIASNENMETMESST
1ohcA1          AAYGSCLLDCFHAVKKAMQ---------------------------------------------------
1fl9A           ----------------------------------------------------------------------
1zp6A1          DQALQSAINALQ----------------------------------------------------------
1jb1A           ----------------------------------------------------------------------
1c4oA1          LWERVRYFEERGEVLYAQRLK-------------------------------------------------
1tmkA           --EKVKQTFMKLLDKEIRKGDESITIVDVTNKGIQEVE--ALIWQIVEPVLSTHIDHDK-----------
1i1qA           ----------------------------------------------------------------------
1g6hA           KAKGITFLIIEHRLDIVLNYIDHLYVMFNGQIIAEGRGNVLSDPKVVEIYIG------------------
1jbkA           ----------------------------------------------------------------------
1np6A           DVEGLADFVVEWMQKQ------------------------------------------------------
2vgmA3          ESNGGKALVLSTLHSLGEELDQLTGIACILK---------------------------------------
1l3aA           YI-----PVTKAEFAVLVSAFNFVMPYLLGWHTAV-----------------------------------
2f9hA1          ITIGTTIDYL------------------------------------------------------------
1pv4A3          SLTIIATALIDTGSKXDEVIYEEFKGTGNXEL--------------------------------------
1cd5A           NIKG------------------------------------------------------------------
1lw7A2          LLDKYKVPYIEIESPSYL----------------------------------------------------
1s9hA           ----------------------------------------------------------------------
2pa7A1          SSDCVMMVLASDYYDETDYIRQYDNFKKYIAKIN------------------------------------
2axpA1          ----------------------------------------------------------------------
1ak2A1          SKRGIHSIDASQTPDVVFASIL------------------------------------------------
1g8yA           DTGCSIVFLHHAVLVDNIRWQSYLSSMTSAEAEEWGVD--------------------------------
1g6oA           ----------------------------------------------------------------------
1qhdA1          ----------------------------------------------------------------------
1e3mA2          -----ASKSYGLAVAALAGVPKEV-IKRARQK--------------------------------------
2fggA1          SDLANQLFALTSSDIEASTHQ-------------------------------------------------
2qgmA1          TEXGFTNFAXEEDWGNGLKLNEYIQTGKGNPRE-------------------------------------
1gm5A1          ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
1f8xA           LHDKVWATATYNNDLNGIKTNDIMLGVYIPDEEDVGLG--------------------------------
1dnpA2          AENSVTHLFYNYQYEVNERARDVEVERALRNVVCEGFD--------------------------------
1grqA           HEGEYDVEVDTTHK-ESIECAW------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
1ii8.1          LKKIPQVILVSHDEELK-DAADHVIRISLENGSS------------------------------------
1bs2A1          IKTHEPTTVVTYLFKLT---HQVSSCYDVLWVAGQTEE--------------------------------
1yvuA2          -------VFSLLEK-LGFKKGSKIVVHRDGRLY-------------------------------------
1ni3A1          TSRGANTLEXKAKKEE------------------------------------------------------
1rkbA           LK--------------------------------------------------------------------
1em8A           WRSGKRVLIACEDEKQAYRLDEALWARPAESFVPHNLAGEGPRG--------------------------
1o7d.2          LFS-ALVPAVGFSIYSVSQ---------------------------------------------------
1v47A1          MRLPTGEVWILLQFKPRVGPGNTVALLHGGERVA------------------------------------
1poiA           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1afrA           ADEKRHETAYTKIVEKLFEIDPDGTVLAFADMMRKKIS--------------------------------
1t9hA2          ----------------------------------------------------------------------
3cddA2          ----------------------------------------------------------------------
1iqrA2          RRLKAKAVYALTSHTPYGRYRD------------------------------------------------
1w1wA           RNPDLQFIVISLK-NTMFEKSD------------------------------------------------
1dhyA1          DKLRQAGVAFTRGDEA--LMQQRKVMGLLCLQDPFGLP--------------------------------
3cddA1          SAEYTVTGWRIPQTGKLWNINTLVPVIDEEXLIASILFSEDDAGRLAVISVVRPDAXD------------
1l7lA           ----------------------------------------------------------------------
1mi8A           ----------------------------------------------------------------------
1dwmA           NRNVHAIVLKEGSAMTKDFRCDRVWVIVNDHGVVTSVPH-------------------------------
1yj5A2          S-EG------------------------------------------------------------------
1yr6A1          LRLGATTIPALNKVDLLS----------------------------------------------------
1sbxA           DELHIYCSRCTADQLEILKVXGLPFSAPSCGLITKTDAE-------------------------------
1atrA1          ----------------------------------------------------------------------
1vhhA           MNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSD-------------------------------
1d8jA           ----------------------------------------------------------------------
1ovmA2          ----------------------------------------------------------------------
1xl3C1          ----------------------------------------------------------------------
1g31A           GEVPELCVVHSVGPDVPEGFCGDLTSLPVGQIRNVPHPFV------------------------------
1esmA           DFVDFSIYVDAPEDLLQTWYINRFLKFREGAFTD------------------------------------
1jqjA3          ----------------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------
2gujA1          ----------------------------------------------------------------------
1uouA3          ELVALPLALVLHELGALRLGVGAELLVDVGQRLRRGTPW-------------------------------
1g8fA3          ----------------------------------------------------------------------
1a4iA2          EQVPGFTPRLAILQVGNRDDSNLYINVKLKAAEEIGIKA-------------------------------
1ckeA           QVKGFSNFERLLAEIKLVPAADALVLDSTTLSIEQV----------------------------------
1b77A2          ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------
1oa8A           LSVGDVCISLTLK---------------------------------------------------------
1tueA           ----------------------------------------------------------------------
2je6I3          ----------------------------------------------------------------------
1jqjA2          --DNPLRVQIGSNNIRAHV---------------------------------------------------
1sfjA           QQYNKEVIISHHNFESTPPLDELQFIFF------------------------------------------
1e2hA           ----------------------------------------------------------------------
1heiB1          ----------------------------------------------------------------------
1odfA           FFY-SDLLWRNPEIKSL-----------------------------------------------------
1b0uA           ---------------------------------------------------------------------K
1sgwA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1m3eA1          ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
1ex6A           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
1pf4A1          -----------------------------------------------------DLETERDNGKYEAVNGE
1t06A           ----------------------------------------------------------------------
1jjvA           ----------------------------------------------------------------------
2gx8A1          ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
1ii8.1          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           LVVNGLSLAPDDPHGVTLKQIDLQLRXXXXXXXXXXXXXXQDELFAALSGEAPLDEARTILIDGQAAGDL
1b0uA           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1m3eA1          ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1ex6A           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1khbA1          ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
1pf4A1          ----------------------------------------------------------------------
1ffhA2          ----------------------------------------------------------------------
1urjA           ----------------------------------------------------------------------
1t06A           ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
1jjvA           ----------------------------------------------------------------------
2gx8A1          ----------------------------------------------------------------------
1mjgM           ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
1udwA           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1bmfA3          ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1t3wA           ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
2v3jA1          ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1tljA           ----------------------------------------------------------------------
2iqhA1          LELRSRYWAIRTRSGGNTSSGQISIQPTFSVQRNLPFDRPTIMAASDMRTEMESARPEDVSFQGRGVFEL
1ohcA1          ----------------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1jb1A           ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
1i1qA           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
1np6A           ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
1l3aA           ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1pv4A3          ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
1s9hA           ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
1g8yA           ----------------------------------------------------------------------
1g6oA           ----------------------------------------------------------------------
1qhdA1          ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1gm5A1          ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1dnpA2          ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
1ii8.1          ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
1yvuA2          ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1rkbA           ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1poiA           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1t9hA2          ----------------------------------------------------------------------
3cddA2          ----------------------------------------------------------------------
1iqrA2          ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1l7lA           ----------------------------------------------------------------------
1mi8A           ----------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1sbxA           ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1vhhA           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
1ovmA2          ----------------------------------------------------------------------
1xl3C1          ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------
2gujA1          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
1g8fA3          ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1b77A2          ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------
1oa8A           ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
2je6I3          ----------------------------------------------------------------------
1jqjA2          ----------------------------------------------------------------------
1sfjA           ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
1heiB1          ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
1b0uA           LHVIDLHKRYGGHE--VLKGVSLQARAGDVISIIGSSGSGKSTFLRCINFLEKPSEGA-IIVNGQNINLV
1sgwA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1m3eA1          ---------------TDAVEAVKDIPNGATVLVGGFGLCGIPENLIGALLKTGVKELTAVGVDNFGLGLL
1nijA1          ----------------------------------------------------------------------
1ex6A           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
1mukA           -----------------------------------------------------------PFLKMVSVGPM
1bgxT2          ----------------------------------------------------------------------
1pf4A1          VDVKDVTFTYQGKEKPALSHVSFSIPQGKTVALVGRSGSGKSTIANLFTRFYDVDSGSIC-LDGHDVRDY
1t06A           ---------------------------------------------------------------------V
1jjvA           ----------------------------------------------------------------------
2gx8A1          ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1mm8A           -----------------------------------------------------------------ALHRA
1f2t.1          ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
1ii8.1          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           SITARRRFGAAFIPEQRLGHATVPTMRLSENALLTSHADPGVVRRGFVDRAALLGLVDRVTAAFGVRKAQ
1b0uA           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1m3eA1          ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1ex6A           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1khbA1          ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
1pf4A1          ----------------------------------------------------------------------
1ffhA2          ----------------------------------------------------------------------
1urjA           ----------------------------------------------------------------------
1t06A           ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
1jjvA           ----------------------------------------------------------------------
2gx8A1          ----------------------------------------------------------------------
1mjgM           ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
1udwA           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1bmfA3          ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1t3wA           ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
2v3jA1          ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1tljA           ----------------------------------------------------------------------
2iqhA1          S---------------------------------------------------------------------
1ohcA1          ----------------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1jb1A           ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
1i1qA           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
1np6A           ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
1l3aA           ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1pv4A3          ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
1s9hA           ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
1g8yA           ----------------------------------------------------------------------
1g6oA           ----------------------------------------------------------------------
1qhdA1          ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1gm5A1          ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1dnpA2          ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
1ii8.1          ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
1yvuA2          ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1rkbA           ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1poiA           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1t9hA2          ----------------------------------------------------------------------
3cddA2          ----------------------------------------------------------------------
1iqrA2          ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1l7lA           ----------------------------------------------------------------------
1mi8A           ----------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1sbxA           ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1vhhA           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
1ovmA2          ----------------------------------------------------------------------
1xl3C1          ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------
2gujA1          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
1g8fA3          ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1b77A2          ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------
1oa8A           ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
2je6I3          ----------------------------------------------------------------------
1jqjA2          ----------------------------------------------------------------------
1sfjA           ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
1heiB1          ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
1b0uA           RDKDGQLKVADLRLLRTRLTMVFQHFNLWSHMTVLENVMEAPIQVLGLSKHDARERALKYLAKVGIDERA
1sgwA           ---------------------------------------------------------EIMDALESVEVLD
1ji0A           ----------------------------------------------------------------------
1m3eA1          LQSKQIKRXISSYVGENA---EFERQYLAGELEV-----ELTPQGTLAERIRAGGAGVPAFYTSTGYGTL
1nijA1          ---------------------------------------------------ALLDLLDNLDKDRLVIECT
1ex6A           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
1mukA           LQSTRKYFAQTL---FMAKTVSGLDVNAIDSALLRLRTLGADKKA-----------LTAQLLMVGLQESE
1bgxT2          ----------------------------------------------------------------------
1pf4A1          KLTNLRRHFALVSQNVHLFNDTIANNIAYAAEGEYTREQIEQAARQAHAMEFIENMPQGLDTVIGEN---
1t06A           ATGAMKPIAKKIKLNQELAEELYATGNFAGIIADPKAMSESDFDRW-IDGAYFYMLSDYVVAVTLSESNI
1jjvA           ----------------------------------------------------------------------
2gx8A1          ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1mm8A           ADWAKSVFSSAALGDPRRTARLVNVA---AQLAKYSGKSITISSEG--SKAAQEGAYRFI----RNPNVS
1f2t.1          ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
2pa7A1          --------------------------------------------------------IKRVYYIFDTKGEH
1ii8.1          ------------------------------------------------VRAEENKVRLFVVWEGKERPLT
1uouA3          ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           RDPEAERLSGGNLQKFIVGREILRQPKLLVVNQPSWXXXXXXXXXXXXXXXXXXXGGAAVLVISQDLDEL
1b0uA           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1m3eA1          ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1ex6A           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1khbA1          ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
1pf4A1          ----------------------------------------------------------------------
1ffhA2          ----------------------------------------------------------------------
1urjA           ----------------------------------------------------------------------
1t06A           ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
1jjvA           ----------------------------------------------------------------------
2gx8A1          ----------------------------------------------------------------------
1mjgM           ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
1udwA           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1bmfA3          ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1t3wA           ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
2v3jA1          ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1tljA           ----------------------------------------------------------------------
2iqhA1          ----------------------------------------------------------------------
1ohcA1          ----------------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1jb1A           ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
1i1qA           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
1np6A           ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
1l3aA           ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1pv4A3          ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
1s9hA           ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
1g8yA           ----------------------------------------------------------------------
1g6oA           ----------------------------------------------------------------------
1qhdA1          ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1gm5A1          ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1dnpA2          ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
1ii8.1          ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
1yvuA2          ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1rkbA           ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1poiA           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1t9hA2          ----------------------------------------------------------------------
3cddA2          ----------------------------------------------------------------------
1iqrA2          ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1l7lA           ----------------------------------------------------------------------
1mi8A           ----------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1sbxA           ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1vhhA           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
1ovmA2          ----------------------------------------------------------------------
1xl3C1          ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------
2gujA1          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
1g8fA3          ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1b77A2          ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------
1oa8A           ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
2je6I3          ----------------------------------------------------------------------
1jqjA2          ----------------------------------------------------------------------
1sfjA           ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
1heiB1          ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
1b0uA           QGKYPVHLSGGQQQRVSIARALAMEPDVLLFDEPTSALDPELVGEVLRIMQQLAEEGKTMVVVTHEMGFA
1sgwA           LKKKLGELSQGTIRRVQLASTLLVNAEIYVLDDPVAIDEDSKHKVLKSILEILKEKGIVIISSREE----
1ji0A           ---------GGEQQXLAIGRALXSRPKLLXXDEPSLGLAPILVSEVFEVIQKINQEGTTILLVEQNALGA
1m3eA1          VQEGGSPIKYNKDGSIAIASKPREVREFNGQHFI-LEEAIRGDFALVKAWKADQAGNVTFRKSARNFNLP
1nijA1          GMADPGPIIQTFFSHEVLCQRYLLDGVIALVDAVHADEQMNQFTIAQSQVGYA---DRILLTKTDVAGEA
1ex6A           DIDMQGVKSVKAIPELNARFLFIAPPSVEDLKKRTEESINKRLSAAQAELAYAETGAHDKVIVNDDLDKA
1l7vC           ----TNQLSGGEWQRVRLAAVVLQAGQLLLLDEPXNSLDVAQQSALDKILSALCQQGLAIVXSSHDLNHT
1mukA           ADALAGKIMLQDVNTVQLARVVNLAVPDTWMSLDFDSMFKHHVKLLPK---------DGRHLNTDIPPRM
1bgxT2          ------YKAGRAPTPEDFPRQLALIKELVDLLARLEVPGYEADDVLASLAKKAEKEGYEVRILTADKDLY
1pf4A1          ----GTSLSGGQRQRVAIARALLRDAPVLILDEATSALDTESERAIQAALDELQKNKTVLVIAHRL--ST
1t06A           AQDVADKWIASGAGWSCYCWLLGNRKDNAFSESKIMLEMVKDTIHHSPERTKSAMNNFLNTVYVPLHEKA
1jjvA           RERMKQKLAEQTAPYTLFVVPLLIENKLTALCDRILVVDVSPQTQLARSANFEQ--IQRIMNSQVSQQER
2gx8A1          ----------------------------------------------------------NIVDPGHNVEKV
1n25A           -------LQARFVKQIDFRPKDYLKHCLERSEFLEKRIIQSGIALLLMLIWYRPVAEFAQSIQSRIVEWK
1mm8A           AEAI---RKAGAMQTVKL----AQEFPELLAIEDTTSLSYRHQVAEELGKLGSIQD-KSRGWWVHSVLLL
1f2t.1          -----ERIALGLAFRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKKIPQVILVSHD-EEL
1tmkA           ------------------------------------------------------------TFMKLLDKEI
2vgmA3          ------KAWYG-EKEVVKAAEYGAISYLLLTDKVLHSDNIAQREEYLKLMDSVESNGGKALVLSTLHSLG
2pa7A1          AHKKLEQVLVCLNGSCRVILDDGNIIQEITLDSPAVGLYVGPAVWHEMHDFSSD--CVMMVLASDYYDET
1ii8.1          FLSGGERIALGLAFRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKKIPQVILVSHDE-EL
1uouA3          --------------------------------------------------------ALPLALVLHELGAL


                         *         .         .         .         .         +         .:560
query           LEIADSIAVMYHGRLSPPxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1b0uA           -------------------------------------------------
1sgwA           -------------------------------------------------
1ji0A           -------------------------------------------------
1m3eA1          -------------------------------------------------
1nijA1          -------------------------------------------------
1q3hA           -------------------------------------------------
1ex6A           -------------------------------------------------
1l7vC           -------------------------------------------------
1mukA           -------------------------------------------------
1khbA1          -------------------------------------------------
1e69A           -------------------------------------------------
1zs3A1          -------------------------------------------------
1bgxT2          -------------------------------------------------
1e9rA           -------------------------------------------------
1kgdA           -------------------------------------------------
1pf4A1          -------------------------------------------------
1ffhA2          -------------------------------------------------
1urjA           -------------------------------------------------
1t06A           -------------------------------------------------
2gk3A1          -------------------------------------------------
1jjvA           -------------------------------------------------
2gx8A1          -------------------------------------------------
1mjgM           -------------------------------------------------
2yyeA2          -------------------------------------------------
1qhlA           -------------------------------------------------
1udwA           -------------------------------------------------
1e6cA           -------------------------------------------------
1n25A           -------------------------------------------------
1jalA1          -------------------------------------------------
1bmfA3          -------------------------------------------------
1f46A           -------------------------------------------------
1es6A2          -------------------------------------------------
1mm8A           -------------------------------------------------
1d6jA           -------------------------------------------------
1t3wA           -------------------------------------------------
1xbtA1          -------------------------------------------------
1j1zA2          -------------------------------------------------
1f2t.1          -------------------------------------------------
2v3jA1          -------------------------------------------------
1cr0A           -------------------------------------------------
1vplA           -------------------------------------------------
1tljA           -------------------------------------------------
2iqhA1          -------------------------------------------------
1ohcA1          -------------------------------------------------
1fl9A           -------------------------------------------------
1zp6A1          -------------------------------------------------
1jb1A           -------------------------------------------------
1c4oA1          -------------------------------------------------
1tmkA           -------------------------------------------------
1i1qA           -------------------------------------------------
1g6hA           -------------------------------------------------
1jbkA           -------------------------------------------------
1np6A           -------------------------------------------------
2vgmA3          -------------------------------------------------
1l3aA           -------------------------------------------------
2f9hA1          -------------------------------------------------
1pv4A3          -------------------------------------------------
1cd5A           -------------------------------------------------
1lw7A2          -------------------------------------------------
1s9hA           -------------------------------------------------
2pa7A1          -------------------------------------------------
2axpA1          -------------------------------------------------
1ak2A1          -------------------------------------------------
1g8yA           -------------------------------------------------
1g6oA           -------------------------------------------------
1qhdA1          -------------------------------------------------
1e3mA2          -------------------------------------------------
2fggA1          -------------------------------------------------
2qgmA1          -------------------------------------------------
1gm5A1          -------------------------------------------------
1viaA           -------------------------------------------------
2ancF1          -------------------------------------------------
1f8xA           -------------------------------------------------
1dnpA2          -------------------------------------------------
1grqA           -------------------------------------------------
2vnuD1          -------------------------------------------------
1bccF           -------------------------------------------------
1ii8.1          -------------------------------------------------
1bs2A1          -------------------------------------------------
1yvuA2          -------------------------------------------------
1ni3A1          -------------------------------------------------
1rkbA           -------------------------------------------------
1em8A           -------------------------------------------------
1o7d.2          -------------------------------------------------
1v47A1          -------------------------------------------------
1poiA           -------------------------------------------------
1ckvA           -------------------------------------------------
1afrA           -------------------------------------------------
1t9hA2          -------------------------------------------------
3cddA2          -------------------------------------------------
1iqrA2          -------------------------------------------------
1w1wA           -------------------------------------------------
1dhyA1          -------------------------------------------------
3cddA1          -------------------------------------------------
1l7lA           -------------------------------------------------
1mi8A           -------------------------------------------------
1dwmA           -------------------------------------------------
1yj5A2          -------------------------------------------------
1yr6A1          -------------------------------------------------
1sbxA           -------------------------------------------------
1atrA1          -------------------------------------------------
1vhhA           -------------------------------------------------
1d8jA           -------------------------------------------------
1ovmA2          -------------------------------------------------
1xl3C1          -------------------------------------------------
1g31A           -------------------------------------------------
1esmA           -------------------------------------------------
1jqjA3          -------------------------------------------------
2gtlM1          -------------------------------------------------
1iioA           -------------------------------------------------
2gujA1          -------------------------------------------------
1uouA3          -------------------------------------------------
1g8fA3          -------------------------------------------------
1a4iA2          -------------------------------------------------
1ckeA           -------------------------------------------------
1b77A2          -------------------------------------------------
1pgsA2          -------------------------------------------------
1oa8A           -------------------------------------------------
1tueA           -------------------------------------------------
2je6I3          -------------------------------------------------
1jqjA2          -------------------------------------------------
1sfjA           -------------------------------------------------
1e2hA           -------------------------------------------------
1heiB1          -------------------------------------------------
1odfA           -------------------------------------------------
1b0uA           RHVSSHVIFLHQGKI----------------------------------
1sgwA           LSYCDVNENLHKY------------------------------------
1ji0A           LKVAHYGYVLETGQI----------------------------------
1m3eA1          XCKAAETTVV---------------------------------------
1nijA1          EKLHERLARINARAP----------------------------------
1ex6A           YKELKDFIFA---------------------------------------
1l7vC           LRHAHRAWLLKGGK-----------------------------------
1mukA           GWLRAILRFLGAGM-----------------------------------
1bgxT2          QLLSDRIHVLHPEGY----------------------------------
1pf4A1          IEQADEILVVDEGEI----------------------------------
1t06A           VEIAKEVGIVEVKRDNKK-------------------------------
1jjvA           LKWADDVINNDAELA----------------------------------
2gx8A1          MGVQKQLQEKVDAKK----------------------------------
1n25A           ERLDKEFSLSVYQKM----------------------------------
1mm8A           EATTFRTVGLLHQE-----------------------------------
1f2t.1          KDAADHVIRI---------------------------------------
1tmkA           RKGDESITIVDVTNK----------------------------------
2vgmA3          EELDQLTGIACILK-----------------------------------
2pa7A1          DYIRQYDNFKKYIAK----------------------------------
1ii8.1          KDAADHVIRISLENG----------------------------------
1uouA3          RLGVGAELLVDVGQR----------------------------------