[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for rpal2:ABE38484.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1f0xA1.bssp"
#ERROR : Can't open dsspfile "1w1oA2.bssp"
#ERROR : Can't open dsspfile "1ahuA2.bssp"
#ERROR : Can't open dsspfile "1mbbA1.bssp"
#ERROR : Can't open dsspfile "1i19A2.bssp"
#ERROR : Can't open dsspfile "1fiqB2.bssp"
#ERROR : Can't open dsspfile "1f0xA2.bssp"
#ERROR : Can't open dsspfile "1kuuA.bssp"
#ERROR : Can't open dsspfile "1hskA1.bssp"
#ERROR : Can't open dsspfile "1jroA4.bssp"
#ERROR : Can't open dsspfile "1ffuC2.bssp"
#ERROR : Can't open dsspfile "1t3qC2.bssp"
#ERROR : Can't open dsspfile "1q5zA.bssp"
#ERROR : Can't open dsspfile "1is2A2.bssp"
#ERROR : Can't open dsspfile "1diiA1.bssp"
#ERROR : Can't open dsspfile "2cqaA1.bssp"
#ERROR : Can't open dsspfile "1w1oA1.bssp"
#ERROR : Can't open dsspfile "1ahuA1.bssp"
#ERROR : Can't open dsspfile "1rm6B2.bssp"

## Summary of PDB Search
:489
    5e-37  13%  1f0xA1 [d.58.32.2] D-LACTATE DEHYDROGENASE A:274 -- 567
    7e-33  21%  1w1oA2 [d.145.1.1] CYTOKININ DEHYDROGENASE 1 A:40 -- 245
    1e-32  21%  1ahuA2 [d.145.1.1] VANILLYL-ALCOHOL OXIDASE A:6 -- 273
    4e-32  11%  1mbbA1 [d.145.1.2] URIDINE DIPHOSPHO-N-ACETYLENOLPYRUVYLGLUCOSAMINE
    7e-31  19%  1i19A2 [d.145.1.1] CHOLESTEROL OXIDASE A:57 -- 273
    4e-30   8%  1fiqB2 [d.145.1.3] XANTHINE OXIDASE B:224 -- 414
    3e-29  22%  1f0xA2 [d.145.1.1] D-LACTATE DEHYDROGENASE A:9 -- 273
    2e-28  15%  1kuuA  [d.153.2.1] CONSERVED PROTEIN
    5e-27  19%  1hskA1 [d.145.1.2] UDP-N-ACETYLENOLPYRUVOYLGLUCOSAMINE REDUCTASE
    1e-26  12%  1jroA4 [d.145.1.3] XANTHINE DEHYDROGENASE, CHAIN A A:179 -- 345
    1e-25  14%  1ffuC2 [d.145.1.3] CUTM, FLAVOPROTEIN OF CARBON MONOXIDE C:1 -- 177
    3e-25  14%  1t3qC2 [d.145.1.3] QUINOLINE 2-OXIDOREDUCTASE MEDIUM SUBUNIT C:1 --
    4e-17   8%  1q5zA  [a.196.1.1] SIPA
    4e-17  11%  1is2A2 [a.29.3.2] ACYL-COA OXIDASE A:475 -- 655
    3e-13  17%  1diiA1 [d.58.32.1] P-CRESOL METHYLHYDROXYLASE A:243 -- 521
    2e-09  12%  2cqaA1 [b.40.4.14] RUVB-LIKE 2 A:8 -- 89
    1e-08  19%  1w1oA1 [d.58.32.4] CYTOKININ DEHYDROGENASE 1 A:246 -- 534
    3e-05  17%  1ahuA1 [d.58.32.1] VANILLYL-ALCOHOL OXIDASE A:274 -- 560
    7e-05  28%  1rm6B2 [d.145.1.3] 4-HYDROXYBENZOYL-COA REDUCTASE BETA SUBUNIT B:1
:489

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxRRTARMNIANPPPIVALPPELIARFAALVGDKYAVTDPAELEAYVTEERNLYRGHSPLVLR
1f0xA1          ----------------------------------------------------------------------
1w1oA2          -----------------------------------ALALDGKLRTDSNATAAASTDFGNITSALPAAVLY
1ahuA2          ----------------LTLPPKLSLDFNEFIQDIIRIVGSENVEVISSKDQIVDGSYMKPTHTHDPAIVA
1mbbA1          ------------------------------------------------------------IDHNAQHIVC
1i19A2          ----------------------------------APLPTPPNFPNDIALFQQAYQNWSKEIMLDATWVCS
1fiqB2          ------------------------------------------------------------FEGERVTWIQ
1f0xA2          ---------------------------KAFLNELARLVGSSHLLTDPAKTARYRKGFRS-GQGDALAVVF
1kuuA           ----------------------------------------------------------------------
1hskA1          ---------------------------KDIYQALQQLIPNEKIKVDEP-LKRYTYTK---TGGNADFYIT
1jroA4          -------------------------------------------------------------------AFL
1ffuC2          ------------------------------------------------------------------EYHA
1t3qC2          ------------------------------------------------------------------SYRA
1q5zA           ---------ARETFLGVIRKALEPDTSTPFPVRRAFDGLRAEILPNDTIKSAALKAQCSDIDKHPELKAK
1is2A2          ----------------------------------------------------------------------
1diiA1          ----------------------------------------------------------------------
2cqaA1          ----------------------------------------------------------------------
1w1oA1          ----------------------------------------------------------------------
1ahuA1          ----------------------------------------------------------------------
1rm6B2          ---------------------------------------------------------------------R


                         .         .         *         .         .         .         .:140
query           PGSTAEIAAICKLASETRVALVPQGGNTGLVGGQTPLNGEIVISLKRMDNIREVDTSSNTMTVEAGVILQ
1f0xA1          ----------------------------------------------------------------------
1w1oA2          PSSTGDLVALLSAANSTPGWPYTRGRGHSLMGQAFA-PGGVVVNMASLGDAANVSADGRYVDAGGEQVWI
1ahuA2          PRNVADVQSIVGLANKFSFPLWPISINSGYGGAAPRVSGSVVLDMKNMNRVLEVNVEGAYCVVEPGVTYH
1mbbA1          AEDEQQLLNAWQYATAEGQPVLILGEGSNVLFLEDYRGTVIINR--IKGIEIHDEPDAWYLHVGAGENWH
1i19A2          PKTPQDVVRLANWAHEHDYKIRPRGAMHGWTPLTVEANVEKVILADTMTHLNGITVNTGTVTAGAGASIE
1fiqB2          ASTLKELLDLKAQHPEAKL--VVGNTEIGIEMKFKNQLFPMIICPAWIPELNAVEHGPEGISFGAACALS
1f0xA2          PGSLLELWRVLKACVTADKIILMQAANTGLTEGSTPNRDVVIISTLRLDKL-HVLGKGEQVLAYPGTTLY
1kuuA           ---------------------LGRILAVGRN----------SNGSFVAYRVSSRSFPNRTTSIQEERVAV
1hskA1          PTKNEEVQAVVKYAYQNEIPVTYLGNGSNIIIREGGIRG-IVISLLSL---DHIEVSDDAIIAGSGAAII
1jroA4          PETSDALADWYLAHPEATL--IAGGTDVSLWVTKALRDLPEVAFLSHCKDLAQIRETPDGYGIGAGVTIA
1ffuC2          PKSVGEAVALLGQL---GSDAKLLAGGHSLLPMMKLAQPEHLIDINRIPELRGIREEGSTVVIGAMTVEN
1t3qC2          PASLQEVIQVLADDPDARI--IAGGQSLLPLLAFRLVYPSCLVDLRNVSELFEISQSAGILSVGAMVTHF
1q5zA           METLKEVITHHPQKEKLAEIALQFAREAGLTYVLSNVLDGLIGDGSWR----------------------
1is2A2          ----------------------------------------------------------------------
1diiA1          ----------------------------------------------------------------------
2cqaA1          -----------------------------PATGTGSKVGKLTLKTTEMETIYDLGTKMIESLTKDKVQAG
1w1oA1          ----------------------------------------------------------------------
1ahuA1          ----------------------------------------------------------------------
1rm6B2          PATLAD--AVNALAAEATLPL---GAGTDLLGLGHP---AALVDLTGIDGLATISLADGSLRIGAGATLE


                         +         .         .         .         .         *         .:210
query           HAQERAASVDRLFPLSLGAQGSCTIGGNLSTNXXXXXXXXXXXXRDMALGLEVVLADGRILNLLSKLKKD
1f0xA1          ----------------------------------------------------------------------
1w1oA2          DVLRASLARGV-APRSWTDYLYLTVGGTLSNAGISGQAFRHGPQISNVLEMDVITGHGEMVT-----CSK
1ahuA2          DLHNYLEANNLRDKLWLDVPDLGGGSVLGNAVERGVGYTPYGDHWMMHSGMEVVLANGELLRTMGLKPED
1mbbA1          RLVKYTLQ-EGMPGLENLALIPGCVGSSPIQNIGAYGVEL----QRVCAYVDSVELATGKQVRLTA--KE
1i19A2          AIV-TELQKHDLGWANLPAPGVLSIGGALAVNQTTLPGHTYGSLSNLVTELTAVVWNGTTYAL-----ET
1fiqB2          SVEKTLLEAVAKLPTQKTEVF-RGVLEQLRWFAGKQVKSVASLGSDLNPVFMASGTKLTIVSRGTRRTVP
1f0xA2          SLEKALKPLGREPHSVIGSCIGASVIGGICNNSGGSLVQRGPA-YTEMSLFARINEDGKL------TLVN
1kuuA           VPVEGHER--DVFRNPYIAYNCIRIVGDTAVVSNGSHTDTIADKVRDAIGLSLLAMDYEKDEL-------
1hskA1          DVSRVARDYA-LTGLEFACGIPGSIGGAVYMN----AGAYGGEVKDCIDYALCVNEQGSLI----KLTTK
1jroA4          ALRAFAEGPHPALAGLLRRFASEQVRQVIGGNIANGSPIGDGPPALIAMGASLTLRRGQE------RRRM
1ffuC2          DLISSPIVQARLPLLDPQVRNRGTIGGDIAHG----DPGNDHPALSIAVEAHFVLEGPNG------RRTV
1t3qC2          RNKTDPTVAKCVPILPKAVRNRGTLGGSLAHA----DAGAEMPFLMATLGATMYIASSAGV---------
1q5zA           ----------------------------------------------------------------------
1is2A2          ----------------------------------------------------------------------
1diiA1          ----------------------------------------------------------------------
2cqaA1          D----------VITIDKATGKISKLGR-------------------------------------------
1w1oA1          ----------------------------------------------------------------------
1ahuA1          ----------------------------------------------------------------------
1rm6B2          AIAEHDAIRTTWPALAQAAESAATLGGNLCQD--------------------------------------


                         .         .         .         +         .         .         .:280
query           NTGYDLRDLFIGAEGTLGIITAATLKLFPKPRAVETAFVGLQSPADALKLLGIAQAEAAGNLTSFELIAE
1f0xA1          -------------------------------KNQQVFYIGTNQPEVLTEIRRHILANFENLPVAGEYMHR
1w1oA2          QLNADLFDAVLGGLGQFGVITRARIAVEP-----------------------------------------
1ahuA2          QPWSKIAHLFLFSQSNMGIVTKIGIWLMPNP---------------------------------------
1mbbA1          CRFGYRDSIFKHEYQDRFAIVAVGLRLPKEWQPVLTYGD-------------------------------
1i19A2          YQRNDPRITPLLTNLGRCFLTSVTMQAGP-----------------------------------------
1fiqB2          MDHTFFPSYRKTLLGPEEILLSIEIPYSRE----------------------------------------
1f0xA2          HLGIDLGETPEQILSKL-----------------------------------------------------
1kuuA           -NTPRIAAAINGSEAFIGIVTADGLMVSRVPEETPVYISTYEQTEPAATEF-----KAGSPEEAAEFI--
1hskA1          ELELDYRNSIIQ--KEHLVVLEAAFTLAP-----------------------------------------
1jroA4          PLEDFFLEYRKQDRRPGEFVESVTLPK-------------------------------------------
1ffuC2          PADGFFLGTYMTLLEENEVMVEIRVPAFA-----------------------------------------
1t3qC2          -RSVSATDFMKGHYFTDEVLVRVEIPIPA-----------------------------------------
1q5zA           ----------------------------------------------------------------------
1is2A2          -------------------------------------------------------------TEAYKLRAA
1diiA1          ----------------------------------------------------------------------
2cqaA1          ----------------------------------------------------------------------
1w1oA1          ----------------------------------------------------------------------
1ahuA1          ----------------------------------------------------------------------
1rm6B2          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           IALDFSVRHGHNRDPLQSRHPWYVLIELSSMRDDARGALEAILERGFEEGVVVDAAIATSLTQQQAFWKL
1f0xA1          DIYDIAELPPRMKNWRD-KYEHHLLLKMADGVGEAKSWLVDYFKQA-----EGDFFVCTPEEGSKAFLHR
1w1oA2          ----------------------------------------------------------------------
1ahuA2          ----------------------------------------------------------------------
1mbbA1          ----------------------------------------------------------------------
1i19A2          ----------------------------------------------------------------------
1fiqB2          ----------------------------------------------------------------------
1f0xA2          ----------------------------------------------------------------------
1kuuA           ----------------------------------------------------------------------
1hskA1          ----------------------------------------------------------------------
1jroA4          ----------------------------------------------------------------------
1ffuC2          ----------------------------------------------------------------------
1t3qC2          ----------------------------------------------------------------------
1q5zA           ----------------------------------------------------------------------
1is2A2          RLVEIAAKNLQTVSHRKSKEVAWNLTS-----VDLVRASEAHCHYVVVKVFSDKLPKIQDKAVQAVLRNL
1diiA1          ----------------------------------------------------------------------
2cqaA1          ----------------------------------------------------------------------
1w1oA1          -------------------HPWLMFVPRSRIADFDRGVFKGILQGTDIVGPLIVYPLNKSM------WDD
1ahuA1          ----------------------------------------------------------------------
1rm6B2          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           REEISPAQKPEGGSIKHDVSVPVAAVPQFIDEANAAVVGLIPGARPVPFGHLGDGNIHYNVTQPVDADKA
1f0xA1          FRYQAVHSDEVEDILALDIALRRNDTEWYEHLPPEI---DSQLVHKLYYGHFMCYVFHQDYIVKKGV---
1w1oA2          ----------------------------------------------------------------------
1ahuA2          ----------------------------------------------------------------------
1mbbA1          ----------------------------------------------------------------------
1i19A2          ----------------------------------------------------------------------
1fiqB2          ----------------------------------------------------------------------
1f0xA2          ----------------------------------------------------------------------
1kuuA           ----------------------------------------------------------------------
1hskA1          ----------------------------------------------------------------------
1jroA4          ----------------------------------------------------------------------
1ffuC2          ----------------------------------------------------------------------
1t3qC2          ----------------------------------------------------------------------
1q5zA           ----------------------------------------------------------------------
1is2A2          CLLYSLYGISQKGDFLEGSIITGAQLSQVNARILELLTLIRPNAVALVAFDFKDMTLGSVLGRYDGNVYE
1diiA1          --------------------------------------------------IVAPRDMHHVIDVLYDRTNP
2cqaA1          ----------------------------------------------------------------------
1w1oA1          G-----------------MSAATP------SEDVFYAVSLLFSSNDLA---------------RLQEQNR
1ahuA1          --------------------------------------------------TVGMREMHHIVCIVFNKKDL
1rm6B2          ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           AFLGRWHEVNTVVFAIVMRLGGSISAEHGIGVMKRDELPGVKDQTAIELMRAIKAMLDPQGIMNPGKVL
1f0xA1          ----DVHALKEQMLELLQQRGAQYPAEHNVGHLYKA----------PETLQKFYRENDPTNSMNPGIGK
1w1oA2          ---------------------------------------------------------------------
1ahuA2          ---------------------------------------------------------------------
1mbbA1          ---------------------------------------------------------------------
1i19A2          ---------------------------------------------------------------------
1fiqB2          ---------------------------------------------------------------------
1f0xA2          ---------------------------------------------------------------------
1kuuA           ---------------------------------------------------------------------
1hskA1          ---------------------------------------------------------------------
1jroA4          ---------------------------------------------------------------------
1ffuC2          ---------------------------------------------------------------------
1t3qC2          ---------------------------------------------------------------------
1q5zA           ---------------------------------------------------------------------
1is2A2          NLFEWAKK-------------------------------------------------------------
1diiA1          EETKRADACFNELLDEFEKEGYAV---YRVNTRFQDRVAQSYGPVKRKLEHAIKRAVDPNNILAPGR--
2cqaA1          ---------------------------------------------------------------------
1w1oA1          RILRFCDLAGIQY--------KTYLARHTDRSDWVRHFGAAK----WNRFVEMKNKYDPKRLLSPGQ--
1ahuA1          IQKRKVQWMRTLIDDCAAN-GWGEYRTHLAFMDQIMETYNWNNSSFLRFNEVLKNAVDPNGIIAPGK--
1rm6B2          ---------------------------------------------------------------------