[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for rpal2:ABE38488.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1o89A2.bssp"
#ERROR : Can't open dsspfile "1h2bA2.bssp"
#ERROR : Can't open dsspfile "1yb5A2.bssp"
#ERROR : Can't open dsspfile "1a71A2.bssp"
#ERROR : Can't open dsspfile "1v3tA2.bssp"
#ERROR : Can't open dsspfile "1kolA1.bssp"
#ERROR : Can't open dsspfile "1pqwA.bssp"
#ERROR : Can't open dsspfile "1ztpA1.bssp"
#ERROR : Can't open dsspfile "1iyzA2.bssp"
#ERROR : Can't open dsspfile "1e3jA2.bssp"
#ERROR : Can't open dsspfile "1lluA2.bssp"
#ERROR : Can't open dsspfile "1vj0A2.bssp"
#ERROR : Can't open dsspfile "1bxzA2.bssp"
#ERROR : Can't open dsspfile "1o89A1.bssp"
#ERROR : Can't open dsspfile "1qorA1.bssp"
#ERROR : Can't open dsspfile "1iyzA1.bssp"
#ERROR : Can't open dsspfile "1e3jA1.bssp"
#ERROR : Can't open dsspfile "1gu7A1.bssp"
#ERROR : Can't open dsspfile "1a9xA3.bssp"
#ERROR : Can't open dsspfile "1a71A1.bssp"
#ERROR : Can't open dsspfile "1kolA2.bssp"
#ERROR : Can't open dsspfile "1v3tA1.bssp"
#ERROR : Can't open dsspfile "1zjcA1.bssp"
#ERROR : Can't open dsspfile "1wkvA1.bssp"
#ERROR : Can't open dsspfile "1o8cA2.bssp"
#ERROR : Can't open dsspfile "1bxzA1.bssp"
#ERROR : Can't open dsspfile "1gv8A.bssp"
#ERROR : Can't open dsspfile "1f8fA1.bssp"
#ERROR : Can't open dsspfile "1vj0A1.bssp"
#ERROR : Can't open dsspfile "1vj1A1.bssp"
#ERROR : Can't open dsspfile "1piwA2.bssp"
#ERROR : Can't open dsspfile "1cjcA1.bssp"
#ERROR : Can't open dsspfile "1qorA2.bssp"
#ERROR : Can't open dsspfile "1uufA1.bssp"
#ERROR : Can't open dsspfile "1y88A2.bssp"
#ERROR : Can't open dsspfile "1escA.bssp"
#ERROR : Can't open dsspfile "1edzA1.bssp"
#ERROR : Can't open dsspfile "1gu7A2.bssp"
#ERROR : Can't open dsspfile "2c54A1.bssp"
#ERROR : Can't open dsspfile "1e0tA3.bssp"
#ERROR : Can't open dsspfile "1aorA1.bssp"
#ERROR : Can't open dsspfile "1p9oA.bssp"
#ERROR : Can't open dsspfile "2ck3H2.bssp"
#ERROR : Can't open dsspfile "1a27A.bssp"
#ERROR : Can't open dsspfile "2hjsA1.bssp"
#ERROR : Can't open dsspfile "1snyA.bssp"
#ERROR : Can't open dsspfile "1h5qA.bssp"
#ERROR : Can't open dsspfile "1c3vA1.bssp"
#ERROR : Can't open dsspfile "1suiA1.bssp"
#ERROR : Can't open dsspfile "2a35A1.bssp"
#ERROR : Can't open dsspfile "1jvsA2.bssp"
#ERROR : Can't open dsspfile "1i24A.bssp"
#ERROR : Can't open dsspfile "1a4iA1.bssp"
#ERROR : Can't open dsspfile "1a9yA.bssp"
#ERROR : Can't open dsspfile "1qycA.bssp"
#ERROR : Can't open dsspfile "1k6iA.bssp"
#ERROR : Can't open dsspfile "1bdbA.bssp"
#ERROR : Can't open dsspfile "2bgkA1.bssp"
#ERROR : Can't open dsspfile "1ae1A.bssp"
#ERROR : Can't open dsspfile "2ayiA1.bssp"
#ERROR : Can't open dsspfile "1vm6A3.bssp"
#ERROR : Can't open dsspfile "1npdA1.bssp"
#ERROR : Can't open dsspfile "2ib0A1.bssp"

## Summary of PDB Search
:339
    1e-28  22%  1o89A2 [c.2.1.1] YHDH A:116 -- 292
    2e-28  26%  1h2bA2 [c.2.1.1] ALCOHOL DEHYDROGENASE A:155 -- 326
    1e-27  29%  1yb5A2 [c.2.1.1] QUINONE OXIDOREDUCTASE A:121 -- 294
    2e-27  18%  1a71A2 [c.2.1.1] LIVER ALCOHOL DEHYDROGENASE A:164 -- 339
    6e-26  26%  1v3tA2 [c.2.1.1] LEUKOTRIENE B4 12- A:113 -- 294
    7e-26  18%  1kolA1 [b.35.1.2] FORMALDEHYDE DEHYDROGENASE A:2 -- 160 A:356 --
    2e-25  32%  1pqwA  [c.2.1.1] POLYKETIDE SYNTHASE
    8e-25   8%  1ztpA1 [d.86.1.2] BASOPHILIC LEUKEMIA EXPRESSED PROTEIN BLES03 A:17
    2e-24  30%  1iyzA2 [c.2.1.1] QUINONE OXIDOREDUCTASE A:99 -- 269
    3e-24  22%  1e3jA2 [c.2.1.1] NADP(H)-DEPENDENT KETOSE REDUCTASE A:143 -- 312
    5e-24  23%  1lluA2 [c.2.1.1] ALCOHOL DEHYDROGENASE A:144 -- 309
    3e-22  19%  1vj0A2 [c.2.1.1] ALCOHOL DEHYDROGENASE, ZINC-CONTAINING A:156 --
    1e-20  22%  1bxzA2 [c.2.1.1] NADP-DEPENDENT ALCOHOL DEHYDROGENASE A:140 -- 313
    1e-20  22%  1o89A1 [b.35.1.2] YHDH A:1 -- 115 A:293 -- 323
    2e-18  19%  1qorA1 [b.35.1.2] QUINONE OXIDOREDUCTASE A:2 -- 112 A:292 -- 327
    4e-18  32%  1iyzA1 [b.35.1.2] QUINONE OXIDOREDUCTASE A:1 -- 98 A:270 -- 302
    5e-18  17%  1e3jA1 [b.35.1.2] NADP(H)-DEPENDENT KETOSE REDUCTASE A:4 -- 142
    5e-18  15%  1gu7A1 [b.35.1.2] 2,4-DIENOYL-COA REDUCTASE A:23 -- 160 A:350 --
    6e-18  16%  1a9xA3 [c.30.1.1] CARBAMOYL PHOSPHATE SYNTHETASE (LARGE CHAIN) A:1
    7e-18  15%  1a71A1 [b.35.1.2] LIVER ALCOHOL DEHYDROGENASE A:1 -- 163 A:340 --
    1e-17  18%  1kolA2 [c.2.1.1] FORMALDEHYDE DEHYDROGENASE A:161 -- 355
    1e-17  10%  1v3tA1 [b.35.1.2] LEUKOTRIENE B4 12- A:1 -- 112 A:295 -- 329
    1e-15  14%  1zjcA1 [e.60.1.1] AMINOPEPTIDASE AMPS A:3 -- 415
    3e-15   9%  1wkvA1 [c.79.1.1] CYSTEINE SYNTHASE A:2 -- 383
    3e-15  30%  1o8cA2 [c.2.1.1] YHDH A:116 -- 192
    6e-15  18%  1bxzA1 [b.35.1.2] NADP-DEPENDENT ALCOHOL DEHYDROGENASE A:1 -- 139
    2e-14   8%  1gv8A  [c.94.1.2] OVOTRANSFERRIN
    5e-14  16%  1f8fA1 [b.35.1.2] BENZYL ALCOHOL DEHYDROGENASE A:4 -- 162 A:337 --
    1e-13  17%  1vj0A1 [b.35.1.2] ALCOHOL DEHYDROGENASE, ZINC-CONTAINING A:2 -- 155
    2e-13  12%  1vj1A1 [b.35.1.2] PUTATIVE NADPH-DEPENDENT OXIDOREDUCTASE A:-1 --
    5e-11  25%  1piwA2 [c.2.1.1] HYPOTHETICAL ZINC-TYPE ALCOHOL DEHYDROGENASE-
    7e-11  12%  1cjcA1 [c.3.1.1] PROTEIN (ADRENODOXIN REDUCTASE) A:107 -- 331
    2e-10  34%  1qorA2 [c.2.1.1] QUINONE OXIDOREDUCTASE A:113 -- 291
    2e-09  14%  1uufA1 [b.35.1.2] ZINC-TYPE ALCOHOL DEHYDROGENASE-LIKE PROTEIN A:3
    2e-09  10%  1y88A2 [c.52.1.30] HYPOTHETICAL PROTEIN AF1548 A:3 -- 127
    2e-08   7%  1escA  [c.23.10.1] ESTERASE
    8e-08  14%  1edzA1 [c.2.1.7] 5,10-METHYLENETETRAHYDROFOLATE DEHYDROGENASE A:149
    3e-07  19%  1gu7A2 [c.2.1.1] 2,4-DIENOYL-COA REDUCTASE A:161 -- 349
    1e-06  14%  2c54A1 [c.2.1.2] GDP-MANNOSE-3', 5'-EPIMERASE A:13 -- 374
    2e-06  12%  1e0tA3 [c.49.1.1] PYRUVATE KINASE A:354 -- 470
    4e-06  15%  1aorA1 [a.110.1.1] ALDEHYDE FERREDOXIN OXIDOREDUCTASE A:211 -- 605
    8e-06  13%  1p9oA  [c.72.3.1] PHOSPHOPANTOTHENOYLCYSTEINE SYNTHETASE
    1e-05  18%  2ck3H2 [b.93.1.1] ATP SYNTHASE DELTA CHAIN H:17 -- 101
    4e-05  17%  1a27A  [c.2.1.2] 17-BETA-HYDROXYSTEROID-DEHYDROGENASE
    5e-05  19%  2hjsA1 [c.2.1.3] USG-1 PROTEIN HOMOLOG A:3 -- 129 A:320 -- 336
    6e-05  23%  1snyA  [c.2.1.2] SNIFFER CG10964-PA
    1e-04  20%  1h5qA  [c.2.1.2] NADP-DEPENDENT MANNITOL DEHYDROGENASE
    1e-04  28%  1c3vA1 [c.2.1.3] DIHYDRODIPICOLINATE REDUCTASE A:501 -- 605 A:715
    1e-04  14%  1suiA1 [c.66.1.1] CAFFEOYL-COA O-METHYLTRANSFERASE A:21 -- 247
    2e-04  10%  2a35A1 [c.2.1.2] HYPOTHETICAL PROTEIN PA4017 A:4 -- 215
    2e-04  16%  1jvsA2 [c.2.1.3] 1-DEOXY-D-XYLULOSE 5-PHOSPHATE REDUCTOISOMERASE
    2e-04  14%  1i24A  [c.2.1.2] SULFOLIPID BIOSYNTHESIS PROTEIN SQD1
    3e-04  16%  1a4iA1 [c.2.1.7] METHYLENETETRAHYDROFOLATE DEHYDROGENASE / A:127 --
    3e-04  22%  1a9yA  [c.2.1.2] UDP-GALACTOSE 4-EPIMERASE
    3e-04  15%  1qycA  [c.2.1.2] PHENYLCOUMARAN BENZYLIC ETHER REDUCTASE PT1
    3e-04  16%  1k6iA  [c.2.1.2] NMRA
    4e-04  22%  1bdbA  [c.2.1.2] CIS-BIPHENYL-2,3-DIHYDRODIOL-2,3-DEHYDROGENASE
    4e-04  23%  2bgkA1 [c.2.1.2] RHIZOME SECOISOLARICIRESINOL DEHYDROGENASE A:11 --
    5e-04  19%  1ae1A  [c.2.1.2] TROPINONE REDUCTASE-I
    7e-04  16%  2ayiA1 [e.60.1.1] AMINOPEPTIDASE T A:3 -- 408
    7e-04  14%  1vm6A3 [c.2.1.3] DIHYDRODIPICOLINATE REDUCTASE A:1 -- 96 A:183 --
    8e-04  19%  1npdA1 [c.2.1.7] HYPOTHETICAL SHIKIMATE 5-DEHYDROGENASE-LIKE A:107
    9e-04   7%  2ib0A1 [a.25.1.9] CONSERVED HYPOTHETICAL ALANINE RICH PROTEIN A:17
:339

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MRAMVLREHGGLEKLSFDSNFPDPDIGPGDVLLRVRATSLNYHDIFTRRGMPGIKIPLPVIMGLDXXXXX
1o89A2          ----------------------------------------------------------------------
1h2bA2          ----------------------------------------------------------------------
1yb5A2          ----------------------------------------------------------------------
1a71A2          ----------------------------------------------------------------------
1v3tA2          ----------------------------------------------------------------------
1kolA1          NRGVVYLGSGKVEVQKIDMQDPRGKKIEHGVILKVVSTNICGSDQHMVRGRTTAQ--VGLVLGHEITGEV
1pqwA           ----------------------------------------------------------------------
1ztpA1          ----------------------------------------------------------------------
1iyzA2          ----------------------------------------------------------------------
1e3jA2          ----------------------------------------------------------------------
1lluA2          ----------------------------------------------------------------------
1vj0A2          ----------------------------------------------------------------------
1bxzA2          ----------------------------------------------------------------------
1o89A1          -------------------TLDESRLPEGDVTVDVHWSSLNYKDALAITGKGKIIRNFPMIPGID--FAG
1qorA1          -TRIEFHKHGGPEVLQAV-EFTPADPAENEIQVENKAIGINFIDTYIRSGLYPPP-SLPSGLGTEAAGIV
1iyzA1          MKAWVLKRLGGPLELV---DLPEPEAEEGEVVLRVEAVGLNFADHLMRLGAYLTRLHPPFIPGMEV----
1e3jA1          LSAVL----YKQNDLRLE-QRPIPEPKEDEVLLQMAYVGICGSDVHYYERIADFIVKDPMVIGHEASGTV
1gu7A1          AQAVLYTQHGEPKDVLFSFEIDDDNLAPNEVIVKTLGSPVNPSDINQIQGVYPSKPAKTTGFGTTEPAAP
1a9xA3          ----------------------------------------------------------------------
1a71A1          CKAAVLWEEKKPFSIE---EVEVAPPKAHEVRIKMVATGICRSDDHVVSGTLVT--PLPVIAGHEAAGIV
1kolA2          ----------------------------------------------------------------------
1v3tA1          AKSWTLKKHPTQSDFELKT-VELPPLKNGEVLLEALFLSVDPYMRIASKRLK----EGAVMMGQQVARVV
1zjcA1          ----------------------------------------------------------------------
1wkvA1          ----------------------------GFSYLENAREVLRSGEARCLGNPRSEPEYVKALYVIGASRIP
1o8cA2          ----------------------------------------------------------------------
1bxzA1          MKGFAMLSIGKVG----WIEKEKPAPGPFDAIVRPLAVAPCTSDIHTVFEG-AIGERHNMILGHEAVGEV
1gv8A           ---------------------AVVKKGTDFMIKDLRGKTSCHTGLGRSAGWN------IPIGTLIHRGDI
1f8fA1          IIAAVTPCKGADFELQ---ALKIRQPQGDEVLVKVVATGMCHTDLIVRDQKYP--VPLPAVLGHEGSGII
1vj0A1          AHAMVLEKFNQPLVYK---EFEISDIPRGSILVEILSAGVCGSDVHMFRGEDPR-VPLPIILGHEGAGRV
1vj1A1          VLNSRPGKNGNAENFRVEEFSLLDALNEGQVQVRTLYLSVDPYXRCKXNEDTGTDYLAPWQLAADGGGIG
1piwA2          ----------------------------------------------------------------------
1cjcA1          ----------------------------------------------------------------------
1qorA2          ----------------------------------------------------------------------
1uufA1          IKAVGAYSAKQPLEPM---DITRREPGPNDVKIEIAYCGVCHSDLHQVRSE-WAGTVYPCVPGHEIVGRV
1y88A2          ----------------------------------------------------------------------
1escA           ----------------------------------------------------------------------
1edzA1          ----------------------------------------------------------------------
1gu7A2          ----------------------------------------------------------------------
2c54A1          ----------------------------------------------------------------------
1e0tA3          APLIVVATQGGKSAR------AVRKYFPDATILALTTNEKTAHQLVLSKGVVPQLVK-EITSTDDFYRLG
1aorA1          ----------------------------------------------------------------------
1p9oA           ----------------------------------------------------------------------
2ck3H2          ---------ASPTQVFFN-QVDVPTLRPGLVVVFVSSGSQLLAEEAVT----------------------
1a27A           ----------------------------------------------------------------------
2hjsA1          ----------------------------------------------------------------------
1snyA           ----------------------------------------------------------------------
1h5qA           ----------------------------------------------------------------------
1c3vA1          ----------------------------------------------------------------------
1suiA1          ----------------------------------------------------------------------
2a35A1          ----------------------------------------------------------------------
1jvsA2          ----------------------------------------------------------------------
1i24A           ----------------------------------------------------------------------
1a4iA1          ----------------------------------------------------------------------
1a9yA           ----------------------------------------------------------------------
1qycA           ----------------------------------------------------------------------
1k6iA           ----------------------------------------------------------------------
1bdbA           ----------------------------------------------------------------------
2bgkA1          ----------------------------------------------------------------------
1ae1A           ----------------------------------------------------------------------
2ayiA1          ----------------------------------------------------------------------
1vm6A3          ----------------------------------------------------------------------
1npdA1          ----------------------------------------------------------------------
2ib0A1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           XXXXXXXXXXXXXDRVLVDPLNRVEGGLMGETMNGGLAELCKARAHQLVRIPDNVSFEQAAALPVAYGTA
1o89A2          -------------------------------------------------------DARKAMIIGTAGFTA
1h2bA2          --------------------------------------------------ISRE-KLVEMAPLADAGITA
1yb5A2          ------------------------------------------------------LDFKQGAAIGIPYFTA
1a71A2          --------------------------------------------------------LEKVCLIGCGFSTG
1v3tA2          --------------------------------------------------LPLSLA---LGTIGMPGLTA
1kolA1          IEKGRDVENLQIGDLVSVPFAGGAYGYVDMGDWTGGQAELVPYADFNLLKLPDRDKAMEKINIAEVVGVQ
1pqwA           ----------------------------------------------------------EAATFGVAYLTA
1ztpA1          ---------------------------------PVGWIAVYGQGYSPNSGDVQGLQAAWEALQTSGRPIT
1iyzA2          ------------------------------------------------------LSPEEAAAFPVSFLTA
1e3jA2          ------------------------------------------------------VSLE-EGALLEPLSVG
1lluA2          ------------------------------------------------------VEFAEIAPILCAGVTV
1vj0A2          --------------------------------------------------------LDVLAMAMCSGATA
1bxzA2          ------------------------------------------------------IPLEAAVMIPDMMTTG
1o89A1          TVRTSEDPRFHAGQEV------LLTGWGVGENHWGGLAEQARVKGDWLVAMPQGQAAKEISLSEAPNFAE
1qorA1          SKVGSGVKHIKAGDRVVYAQ-----------SALGAYSSVHNIIADKAAILPAAIKVDVAEQQKYPLKDA
1iyzA1          ---------------VGVVEGRRYAALVPQ----GGLAERVAVPKGALLPLPEGRPVV-GPVFPFAEAAA
1e3jA1          VKVGKNVKHLKKGDRVAVEPLCPDLTFCATPPDDGNLARYYVHAADFCHKLPDNCNVKQLVTHSFKLEQT
1gu7A1          CGNEGLFEVIKVGSN--VSSLEAGDWVIPSHVNFGTWRTHALGNDDDFIKLPNPAQSK-ANGKPNGLTDA
1a9xA3          ----------------------------------------------------------------------
1a71A1          ESIGEGVTTVRPGDKVIPLWFCLKNDLSMPRGTMQDGTSRFTCRGKPIHHFLGTSTFSQYTVVDEISVAK
1kolA2          ---------------------------------------------------------RDLTCLSDILPTG
1v3tA1          ESKNSAFPAG---SIV------------LAQSGWTTHFISDGKGLEKLLTEWPDKKIQYHEHVTKGFENM
1zjcA1          -------------------------------------------------------NYKEKLQ-QYAELLV
1wkvA1          VGDGCSHTLEELGVFDISEMVFPSPLDFFERGKPTPLVRS-RLQLPNGVRVWLKLEWYNPFSLSVKDRPA
1o8cA2          -------------------------------------------------------DARKAMIIGTAGFTA
1bxzA1          VEVGSEVKDFKPGDRVVVPAIGMLAGWKFSNVKDGVFGEFFHVNDMNLAHLPKEVDPSKLVTHVRGFDNI
1gv8A           EWEGIESGSVEQAVAKFFDAKTKCLRNAPYSGYSGAFQCLKDGKGDVAFVKHTTVQENAPEEKDEYELLC
1f8fA1          EAIGPNVTELQVGDHVVLEFFGRNFSGADSEFAQSSFATYALSRENNTVKVTKDFPFDQLVKFYAFDEIN
1vj0A1          VEVNGEKRDLNGELLKPGDLIVWNRGCSEYPHLRGCYSSHIVLDPETDVLKVSEKITH-RLPLKEANKAL
1vj1A1          IVEESKHQKLAKGDFVT--------------SFYWPWQTKAILDGNGLEKVDP----------QLVDGLK
1piwA2          --------------------------------------------------IPSHL----AAPLLCGGLTV
1cjcA1          ---------------------------------------------HQALDIPGELPGVFSARAFVGWYNG
1qorA2          ------------------------------------------------------ISFEQAAASFLKGLTV
1uufA1          VAVGDQVEKYAPGDLVGVGCIVDSCKPDEPGHTLGGYSQQIVVHERYVLRIRVADEMIRADQINEAYERM
1y88A2          --------------------------------------------------------QGHARLLEEHGFET
1escA           -------------------------------------PFGAGELPPQQDALKQDTQL--TVGSLGGNTLG
1edzA1          -----------------------------------------------------------AIVKILEFLKI
1gu7A2          ------------------------------------------------------LTINQGATISVNPLTA
2c54A1          --------------------------------------------------------------------TY
1e0tA3          KELALQSGLAHKGDVVVMVS--------------------------------------------------
1aorA1          -------------------------------------QKFMLVVREKVNKLRNDPVAGGGLP---KYGTA
1p9oA           -------------------------------------------------RFAARLGAQGRRVVLVTSGGT
2ck3H2          ----------------------------------------------------------------------
1a27A           ----------------------------------------------------------------------
2hjsA1          ----------------------------------------------------------------------
1snyA           ----------------------------------------------------------------------
1h5qA           ----------------------------------------------------------------------
1c3vA1          ----------------------------------------------------------------------
1suiA1          -------------------------------------------REHEAMKELREVTAKHPWNIMTTSADE
2a35A1          ----------------------------------------------------------------------
1jvsA2          ----------------------------------------------------------------------
1i24A           ----------------------------------------------------------------------
1a4iA1          ------------------------------------------------------------CFIPCTPKGC
1a9yA           ----------------------------------------------------------------------
1qycA           ----------------------------------------------------------------------
1k6iA           ----------------------------------------------------------------------
1bdbA           ----------------------------------------------------------------------
2bgkA1          ----------------------------------------------------------------------
1ae1A           ----------------------------------------------------------------------
2ayiA1          ----------------------------------------------------------------------
1vm6A3          ----------------------------------------------------------------------
1npdA1          ----------------------------------------------------------------------
2ib0A1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           HRMMTTNGHVKAGEKVLILGASGGVGVCCVQLAKIAGAYVIACAGSEEKGQRLKEVGADEVILYTKEDFM
1o89A2          MLCVLEDAGVRPQDEIVVTGASGGVGSTAVALLHKLGYQVVAVSGRESTHEYLKSLGASRVLPRDEFAES
1h2bA2          YRAVKKAARTLYPGAYVAIVGVGGLGHIAVQLLKVMTPAVIALDVKEEKLKLAERLGADHVVDARRDPVK
1yb5A2          YRALIHSACVKAGESVLVHGASGGVGLAACQIARAYGLKILGTAGTEEGQKIVLQNGAHEVFNHREVNYI
1a71A2          YGSAVKVAKVTQGSTCAVFGLGGAGLSVIMGCKAAGAARIIGVDINKDKFAKAKEVGATECVNPQDKKPI
1v3tA2          YFGLLEVCGVKGGETVLVSAAAGAVGSVVGQIAKLKGCKVVGAAGSDEKIAYLKQIGFDAAFNYKTVNSL
1kolA1          VIS------LDDAPRGYGEFDAGVPKKFVIDPHKTFSA--------------------------------
1pqwA           WHSLCEVGRLSPGERVLIHSATGGVGMAAVSIAKMIGARIYTTAGSDAKREMLSRLGVEYVGDSRSVDFA
1ztpA1          PGTLAITHHVLSGKWLXHLAPGFKLDHAWAGIARAVVEGRLVAKVSPRAKEGGRQVICVYTDDFTDRLGV
1iyzA2          YLALKR-AQARPGEKVLVQAAAGALGTAAVQVARAMGLRVLAAASRPEKLALPLALGAEEAATYAEVPER
1e3jA2          VHACRR-AGVQLGTTVLVIGA-GPIGLVSVLAAKAYGAFVVCTARSPRRLEVAKNCGADVTLVVDPAK--
1lluA2          YKGLKQTN-ARPGQWVAISGI-GGLGHVAVQYARAMGLHVAAIDIDDAKLELARKLGASLTVNARQEDPV
1vj0A2          YHAFDEYPESFAGKTVVIQGA-GPLGLFGVVIARSLGAENVIVIGSPNRLKLAEEIGADLTLNRRETSVE
1bxzA2          FHGAEL-ADIELGATVAVLGI-GPVGLMAVAGAKLRAGRIIAVGSRPVCVDAAKYYGATDIVNYKDGPIE
1o89A1          AIIN----NQIQGRTLVKV---------------------------------------------------
1qorA1          QRAHEILSRATQGSSLLI----------------------------------------------------
1iyzA1          FRALLDRGH-------------------------------------------------------------
1e3jA1          VDAFEA-ARKKADNTIKVMISC------------------------------------------------
1gu7A1          KSIETLYDGTKPLHELYQDGANSKDGKQLIT---------------------------------------
1a9xA3          -------PKRTDIKSILILGA-GPIVIGQACEFDYSGAQACKLREEGYRVINVNSNPATIMTDPEMADAT
1a71A1          IDAAFALEKINEGFDLLRSGESIRTIL-------------------------------------------
1kolA2          YHG-AVTAGVGPGSTVYVAGA-GPVGLAAAASARLLGAVVIVGDLNPARLAHAKAQGFEIADLSLDTPLH
1v3tA1          PAAFIEMLNGANLGKAVV----------------------------------------------------
1zjcA1          KVGM----NVQPKQPVFIRSSVETLELTHVEEAYHCGASDVRVVYSDPTLKRLKFENESVEHFANHEIKS
1wkvA1          VEIISRLSRRVEKGSLVADATSSNFGVALSAVARLYGYRARVYLPEEFGKLLPRLLGAQVIVDPEAPSTV
1o8cA2          MLCVMALEDAPQDGEIVVTGASGGVGSTAVALLHKLGYQVVAVSGRESTHEYLKSLGA------------
1bxzA1          EKMLMKDKPKDLIKPVVILA--------------------------------------------------
1gv8A           LDGT--RQPVDSYKTCNWARVAAG----------------------------------------------
1f8fA1          QAAIDS-RKGITLKPIIKIA--------------------------------------------------
1vj0A1          EL-----MESREALKVIL----------------------------------------------------
1vj1A1          VKETVAKGLENXGVAFQSXXTGGNVGKQIVCISEDSS---------------------------------
1piwA2          YSPLVRNG-CGPGKKVGIVGL-GGIGSMGTLISKAMGAETYVISRSSRKREDAMKMGADHYIATLEEDWG
1cjcA1          LPENRELAPDLSCDTAVILGQ-GNVALDVARILLTPPDHLEKTDITEAALGALRQSRVKTVWIVGRRGPL
1qorA2          YYLLRKTYEIKPDEQFLFHAAAGGVGLIACQWAKALGAKLIGTVGTAQKAQSALKAGAWQVINYREEDLV
1uufA1          LR--------------------------------------------------------------------
1y88A2          KTNVIVQGNCVEQEIVVAERDGERYMIECKFHNIPVYTGLKEAMYTYARFLDVEKHGFTQPWIFTNTKFS
1escA           FNRILKQCSDELRKPSLLPGD-PVDGDEPAAKCGEFFGTGDGKQWLDDQFERVGA-ELEELLDRIGYFA-
1edzA1          YNNLLPEGNRLYGKKCIVINRSEIVGRPLAALLANDGATVYSVDVNNIQKFTRGESLKLNKHHVEDLGEY
1gu7A2          YLMLTHYVKLTPGKDFIQNGGTSAVGKYASQIGKLLNFNSISVIRDRPNVASLKELGATQVITEDQNNSR
2c54A1          KELEREQYWPSENLKISITGAGGFIASHIARRLKHEGHYVIASDWKKNEHMFCDEFHLVDLRVMENCLKV
1e0tA3          ----------------------------------------------------------------------
1aorA1          VLVNIINENVKNFQTGVYPYAYEQSGEAMAAKYLVRNKPCYACPIGCGRVNR------------------
1p9oA           KVPLEARPV-----RFLDNFSSGRRGATSAEAFLAAGYGVLFLYRARSAFPYAHRFPPQTWL--------
2ck3H2          ----------------------------------------------------------------------
1a27A           -----------ARTVVLITGCSSGIGLHLAVRLASDPSQSFKVYATLRDLKTQGRLWEAARALACPPGSL
2hjsA1          ------------PLNVAVVGATGSVGEALVGLLDERDFPLHRLHLLASAESAGQR---------------
1snyA           --------HXN---SILITGCNRGLGLGLVKLPQ-PPQHLFTTCRNREQAKELED---------------
1h5qA           -----------VNKTIIVTGGNRGIGLAFTRAVAAAGANVAVIYRSAADAVEVTE---------------
1c3vA1          --------------RVGVLGAKGKVGTTMVRAVAAADDLTLSAELDAGDPLSLLTDGNTEV---------
1suiA1          GQFLSMLLKLINAKNTMEIGVYTGYSLLATALAIPEDGKILAMDINKENYELGLP-VIKKAGVDHKIDFR
2a35A1          ------------PKRVLLAGATGLTGEHLLDRILSEPTLAKVIAPARKALAEHPRLDNPVGPLAELLPQL
1jvsA2          ------------GKQLTILGSTGSIGCSTLDVVRHNPEHFRVVALVAGKNVTRLEFSPRYAVXDDEASA-
1i24A           ------------GSRVMVIGGDGYCGWATALHLSKKNYEVCIVDNLVRRLFDHQL---------------
1a4iA1          LELIKETGVPIAGRHAVVVGRSKIVGAPMHDLLLWNNATVTTCHSKTAHLDEEVNKGDILVVATGQPEMV
1a9yA           --------------RVLVTGGSGYIGSHTCVQLLQNGHDVIILDNLCNSKRSVLP---------------
1qycA           -----------SRSRILLIGATGYIGRHVAKASLDLGHPTFLLVRESTASSNSEKAQLLESFKASGANIV
1k6iA           ----------QQKKTIAVVNATGRQAASLIRVAAAVGHHVRAQVHSLKGLIAEELQAIPNV---------
1bdbA           -----------KGEAVLITGGASGLGRALVDRFVAEGAKVAVLDKSAERLAELETIVGDVRSLEDQKQAA
2bgkA1          -----------QDKVAIITGGAGGIGTTAKLFVR-YGAKVVIADIADDHGQKVCN---------------
1ae1A           -----------KGTTALVTGGSKGIGYAIVEELAGLGARVYTCSRNEKELDECLEIWREKGLNVEGSVCD
2ayiA1          ---------LEKGQEVIATAPAVDFVRLLAEKAYREGASLFTVIYGDQELARKRLALAPEEGLDK-----
1vm6A3          --------------KYGIVGYSGRMGQEIQKVFSEKGHELVLKVDVNGV--------------EELDSPD
1npdA1          -RAIKESGFDIKGKTXVLLGAGGASTAIGAQGAIEGLKEIKLFNRRDEFFDKALA---------------
2ib0A1          ----------EHATIYGYGIVSALSPPGVNFLVADALKQHRHRRDDVIVMLSARG---------------


                         .         .         .         +         .         .         .:280
query           QVVRQRHGRPQRVGGGSSENGGVDVVVNFTGGDTWVKSLRTLKLGGRILTCGATAGYDPAEDLRVIWTFE
1o89A2          RPLE---------------KQVWAGAIDTVGDKVLAKVLAQMNYGGCVAACGLAGGFTLPTTVMPFILRN
1h2bA2          QVMELTRG------------RGVNVAMDFVGSQTVDYTPYLLGRMGRLIIVGYGGELRF--PTIRVISSE
1yb5A2          DKIKKYVG-----------EKGIDIIIEMLANVNLSKDLSLLSHGGRVIVVGSRGTIEI--NPRDTMAKE
1a71A2          QEVLTEMS-----------NGGVDFSFEVIGRLMVTALSCCQEAYGVSVIVGVPPDSQNLSMNPMLLLSG
1v3tA2          EEALKKAS-----------PDGYDCYFDNVGGEFLNTVLSQMKDFGKIAICGAISVYNRMDSPESIIYKQ
1kolA1          ----------------------------------------------------------------------
1pqwA           DEILE-----------LTDGYGVDVVLNSLAGEAIQRGVQILAPGGRFIELGKKDVYDASLGLAALVDLD
1ztpA1          LEADSAIR-----------AAGIKCLLTYKPDVYTYLGIYRANRWHLCPTLYESRFQGSR----------
1iyzA2          AK----------------AWGGLDLVLEVRGKEVE-ESLGLLAHGGRLVYIGAAEAPIPPLRL---MRRN
1e3jA2          ---EEESSIIERI--RSAIGDLPNVTIDCSGNEKCITIGINITRTGGTLMLVGMGSQMVTVPLVNACARE
1lluA2          EAIQRDI------------GGAHGVLVTAVSNSAFGQAIGMARRGGTIALVGLPPGDFPT-PIFDVVLKG
1vj0A2          ERRKAIMDIT--------HGRGADFILEATGDSALLEGSELLRRGGFY-SVAGVAVPQDPVPFKVLVLKN
1bxzA2          SQIMN-----------LTEGKGVDAAIIAGGADIMATAVKIVKPGGTIANVNYFGEGEVLPVPRLEWGCH
1o89A1          ----------------------------------------------------------------------
1qorA1          ----------------------------------------------------------------------
1iyzA1          ----------------------------------------------------------------------
1e3jA1          ----------------------------------------------------------------------
1gu7A1          ----------------------------------------------------------------------
1a9xA3          YIEPIHWEVVRKIIEK----ERPDAVLPTMGGQTALNCALELERQGVLEEFGVTMIGATADAID------
1a71A1          ----------------------------------------------------------------------
1kolA2          EQIAALLGCAVDAVGFEARGHGHEGAKHEAPATVLNSLMQVTRVAGKIGIPGLYVTEDPGAVDAAAKIGS
1v3tA1          ----------------------------------------------------------------------
1zjcA1          YDVEARM---------DYVKRGAANLALISEDPDLMDGIDSQKLQAFQQQNARAFKGYMESVQKNQFPWV
1wkvA1          HLLP------------------------------------------------------------------
1o8cA2          ----------------------------------------------------------------------
1bxzA1          ----------------------------------------------------------------------
1gv8A           ----------------------------------------------------------------------
1f8fA1          ----------------------------------------------------------------------
1vj0A1          ----------------------------------------------------------------------
1vj1A1          ----------------------------------------------------------------------
1piwA2          EKYF----------------DTFDLIVVCASSLTFNIMPKAMKVGGRIVSISI-----PEQHE-MLSLKP
1cjcA1          QVAFTIKELREMIQL-----PGTRPMLDPADFLGLQDRIKEAARPRK-----------------------
1qorA2          ERLKEIT---------------------------------------------------------------
1uufA1          ----------------------------------------------------------------------
1y88A2          EEAKK-----------YAGCVGIKLTGWSYPEKEGIEVLLESKG--------------------------
1escA           ---------------PDAKRVLVGYPRLVPEDKCLTAAPGQTQLPFADIPQDA-----------------
1edzA1          SEDLL-----------------------------------------------------------------
1gu7A2          EFGPTIKEWIKQSGGEALNCVGGKSSTGIARKLNNGLMLTYGGMSFQPVTI-------------------
2c54A1          TEGVDHVFNLAADMGGIQSNHSVIMYNNTMISFNMIEAARINGIKRFFYASSACIYPEFKQLETTNVS--
1e0tA3          ----------------------------------------------------------------------
1aorA1          ----------------------------------------------------------------------
1p9oA           ----------------------------------------------------------------------
2ck3H2          ----------------------------------------------------------------------
1a27A           ETLQLDVRDSKSVAAAREREGRVDVLVC------------------------------------------
2hjsA1          ----------------------------------------------------------------------
1snyA           ----------------------------------------------------------------------
1h5qA           ----------------------------------------------------------------------
1c3vA1          ----------------------------------------------------------------------
1suiA1          E--GPALPVLDEMIKDEKNHGSYDFIFVDADKDNYLNYHDLVKVGGVTLWNGSVVAPPDAPLRKYVRYYR
2a35A1          DGSIDTAFCCLGTTIKEAGSEEAFRAVDFDLPLAVGKRALEMGARHYLVVSALGADAKS-----------
1jvsA2          ----------------------------------------------------------------------
1i24A           ----------------------------------------------------------------------
1a4iA1          KGEWIKPGAIVICGINYKVVGDVAYDEAKER---------------------------------------
1a9yA           ----------------------------------------------------------------------
1qycA           HGSIDDHASLVE------AVKNVDVVISTVGSLQI-----------------------------------
1k6iA           ----------------------------------------------------------------------
1bdbA           SRCVARFGK---------IDTLIPNAGIWDYSTALVDLP-------------------------------
2bgkA1          ----------------------------------------------------------------------
1ae1A           LLSRTERDKLMQ-TVAHVFDGKLNILVNNAGVVIH-----------------------------------
2ayiA1          ----------------------------------------------------------------------
1vm6A3          VVIDFSSPEALPKTVDLCKKYRAGLVLGTTA---------------------------------------
1npdA1          ----------------------------------------------------------------------
2ib0A1          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           LQVRGSNGWERDDIEKLFALLASGKLRAQVDKAFxxxxxxxxxxxxxxxxxxxxxxxxx
1o89A2          VRLQGVDMTPPERWQRLVADLPESFY---------------------------------
1h2bA2          VSFEGSLVGNYVELHELVTLALQGK----------------------------------
1yb5A2          SSIIGVTSSTKEEFQQYAAALQAG-----------------------------------
1a71A2          RTWKGAGFKSKDSVPKLVADFMAKK----------------------------------
1v3tA2          LRIEGFIVYRWQALRDLMKWVLEG-----------------------------------
1kolA1          -----------------------------------------------------------
1pqwA           LNLKLQPARYRQLLQHILQHVADGKLE--------------------------------
1ztpA1          -----------------------------------------------------------
1iyzA2          LAVLGFWLTPLLREGALVEEAL-GFLLPRLGREL-------------------------
1e3jA2          IDIKSVFRY-CNDYPIALEMVASGR----------------------------------
1lluA2          LHIAGSIVGTRADLQEALDFAGEG-----------------------------------
1vj0A2          ATFKGIWVSDTSHFVKTVSITSRNYQ---------------------------------
1bxzA2          KTIKGGCPGGRLRMERLIDLVFYKR----------------------------------
1o89A1          -----------------------------------------------------------
1qorA1          -----------------------------------------------------------
1iyzA1          -----------------------------------------------------------
1e3jA1          -----------------------------------------------------------
1gu7A1          -----------------------------------------------------------
1a9xA3          -----------------------------------------------------------
1a71A1          -----------------------------------------------------------
1kolA2          LSIRFGLGWAKKYNRALMQAIMWDR----------------------------------
1v3tA1          -----------------------------------------------------------
1zjcA1          VAAFPSKAWAKRVYPELSV----------------------------------------
1wkvA1          -----------------------------------------------------------
1o8cA2          -----------------------------------------------------------
1bxzA1          -----------------------------------------------------------
1gv8A           -----------------------------------------------------------
1f8fA1          -----------------------------------------------------------
1vj0A1          -----------------------------------------------------------
1vj1A1          -----------------------------------------------------------
1piwA2          YSISYSALGSIKELNQLLKLVSEKDIK--------------------------------
1cjcA1          -----------------------------------------------------------
1qorA2          -----------------------------------------------------------
1uufA1          -----------------------------------------------------------
1y88A2          -----------------------------------------------------------
1escA           -----------------------------------------------------------
1edzA1          -----------------------------------------------------------
1gu7A2          -----------------------------------------------------------
2c54A1          -----------------------------------------------------------
1e0tA3          -----------------------------------------------------------
1aorA1          -----------------------------------------------------------
1p9oA           -----------------------------------------------------------
2ck3H2          -----------------------------------------------------------
1a27A           -----------------------------------------------------------
2hjsA1          -----------------------------------------------------------
1snyA           -----------------------------------------------------------
1h5qA           -----------------------------------------------------------
1c3vA1          -----------------------------------------------------------
1suiA1          DFVLELNKALAVD----------------------------------------------
2a35A1          -----------------------------------------------------------
1jvsA2          -----------------------------------------------------------
1i24A           -----------------------------------------------------------
1a4iA1          -----------------------------------------------------------
1a9yA           -----------------------------------------------------------
1qycA           -----------------------------------------------------------
1k6iA           -----------------------------------------------------------
1bdbA           -----------------------------------------------------------
2bgkA1          -----------------------------------------------------------
1ae1A           -----------------------------------------------------------
2ayiA1          -----------------------------------------------------------
1vm6A3          -----------------------------------------------------------
1npdA1          -----------------------------------------------------------
2ib0A1          -----------------------------------------------------------