[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for rpal2:ABE38511.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1kskA4.bssp"
#ERROR : Can't open dsspfile "1przA.bssp"
#ERROR : Can't open dsspfile "1k8wA5.bssp"
#ERROR : Can't open dsspfile "2apoA2.bssp"
#ERROR : Can't open dsspfile "1v9kA.bssp"
#ERROR : Can't open dsspfile "1ze2B2.bssp"
#ERROR : Can't open dsspfile "1r3eA2.bssp"
#ERROR : Can't open dsspfile "1vioA2.bssp"
#ERROR : Can't open dsspfile "1jh3A.bssp"
#ERROR : Can't open dsspfile "1p9kA.bssp"
#ERROR : Can't open dsspfile "1kskA3.bssp"
#ERROR : Can't open dsspfile "1dm9A.bssp"
#ERROR : Can't open dsspfile "1fjgD.bssp"
#ERROR : Can't open dsspfile "1h3eA2.bssp"

## Summary of PDB Search
:795
    7e-30  31%  1kskA4 [d.265.1.3] RIBOSOMAL SMALL SUBUNIT PSEUDOURIDINE SYNTHASE A
    8e-23  18%  1przA  [d.265.1.3] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE D
    4e-20  18%  1k8wA5 [d.265.1.2] TRNA PSEUDOURIDINE SYNTHASE B A:9 -- 250
    4e-19  16%  2apoA2 [d.265.1.2] PROBABLE TRNA PSEUDOURIDINE SYNTHASE B A:17 --
    3e-17  19%  1v9kA  [d.265.1.3] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE C
    7e-17  12%  1ze2B2 [d.265.1.2] TRNA PSEUDOURIDINE SYNTHASE B B:1 -- 228
    1e-14  18%  1r3eA2 [d.265.1.2] TRNA PSEUDOURIDINE SYNTHASE B A:10 -- 237
    9e-14  24%  1vioA2 [d.66.1.5] RIBOSOMAL SMALL SUBUNIT PSEUDOURIDINE SYNTHASE A
    3e-10  18%  1jh3A  [d.66.1.4] TYROSYL-TRNA SYNTHETASE
    9e-10  20%  1p9kA  [d.66.1.6] ORF, HYPOTHETICAL PROTEIN
    9e-10  30%  1kskA3 [d.66.1.5] RIBOSOMAL SMALL SUBUNIT PSEUDOURIDINE SYNTHASE A
    3e-09  13%  1dm9A  [d.66.1.3] HYPOTHETICAL 15.5 KD PROTEIN IN MRCA-PCKA
    9e-09  21%  1fjgD  [d.66.1.2] 30S RIBOSOMAL PROTEIN S4
    1e-07  25%  1h3eA2 [d.66.1.4] TYROSYL-TRNA SYNTHETASE A:352 -- 432
:795

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1kskA4          ----------------------------------------------------------------------
1przA           ----------------------------------------------------------------------
1k8wA5          ----------------------------------------------------------------------
2apoA2          ----------------------------------------------------------------------
1v9kA           ----------------------------------------------------------------------
1ze2B2          ----------------------------------------------------------------------
1r3eA2          ----------------------------------------------------------------------
1vioA2          ----------------------------------------------------------------------
1jh3A           ----------------------------------------------------------------------
1p9kA           ----------------------------------------------------------------------
1kskA3          ----------------------------------------------------------------------
1dm9A           ----------------------------------------------------------------------
1fjgD           ----------------------------------------------------------------------
1h3eA2          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1kskA4          ----------------------------------------------------------------------
1przA           ----------------------------------------------------------------------
1k8wA5          ----------------------------------------------------------------------
2apoA2          ----------------------------------------------------------------------
1v9kA           ----------------------------------------------------------------------
1ze2B2          ----------------------------------------------------------------------
1r3eA2          ----------------------------------------------------------------------
1vioA2          ----------------------------------------------------------------------
1jh3A           ----------------------------------------------------------------------
1p9kA           ----------------------------------------------------------------------
1kskA3          ----------------------------------------------------------------------
1dm9A           ----------------------------------------------------------------------
1fjgD           ----------------------------------------------------------------------
1h3eA2          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1kskA4          ----------------------------------------------------------------------
1przA           ----------------------------------------------------------------------
1k8wA5          ----------------------------------------------------------------------
2apoA2          ----------------------------------------------------------------------
1v9kA           ----------------------------------------------------------------------
1ze2B2          ----------------------------------------------------------------------
1r3eA2          ----------------------------------------------------------------------
1vioA2          ----------------------------------------------------------------------
1jh3A           ----------------------------------------------------------------------
1p9kA           ----------------------------------------------------------------------
1kskA3          ----------------------------------------------------------------------
1dm9A           ----------------------------------------------------------------------
1fjgD           ----------------------------------------------------------------------
1h3eA2          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1kskA4          ----------------------------------------------------------------------
1przA           ----------------------------------------------------------------------
1k8wA5          ----------------------------------------------------------------------
2apoA2          ----------------------------------------------------------------------
1v9kA           ----------------------------------------------------------------------
1ze2B2          ----------------------------------------------------------------------
1r3eA2          ----------------------------------------------------------------------
1vioA2          ----------------------------------------------------------------------
1jh3A           ----------------------------------------------------------------------
1p9kA           ----------------------------------------------------------------------
1kskA3          ----------------------------------------------------------------------
1dm9A           ----------------------------------------------------------------------
1fjgD           ----------------------------------------------------------------------
1h3eA2          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1kskA4          ----------------------------------------------------------------------
1przA           ----------------------------------------------------------------------
1k8wA5          ----------------------------------------------------------------------
2apoA2          ----------------------------------------------------------------------
1v9kA           ----------------------------------------------------------------------
1ze2B2          ----------------------------------------------------------------------
1r3eA2          ----------------------------------------------------------------------
1vioA2          ----------------------------------------------------------------------
1jh3A           ----------------------------------------------------------------------
1p9kA           ----------------------------------------------------------------------
1kskA3          ----------------------------------------------------------------------
1dm9A           ----------------------------------------------------------------------
1fjgD           ----------------------------------------------------------------------
1h3eA2          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxPRFDKPREERGGDRPRFSRDDRPKFERRERTGDWHEHPRNEGPSSDRPRSRDNGE
1kskA4          ----------------------------------------------------------------------
1przA           ----------------------------------------------------------------------
1k8wA5          ----------------------------------------------------------------------
2apoA2          ----------------------------------------------------------------------
1v9kA           ----------------------------------------------------------------------
1ze2B2          ----------------------------------------------------------------------
1r3eA2          ----------------------------------------------------------------------
1vioA2          ----------------------------------------------------------------------
1jh3A           ----------------------------------------------------------------------
1p9kA           ----------------------------------------------------------------------
1kskA3          ----------------------------------------------------------------------
1dm9A           ----------------------------------------------------------------------
1fjgD           ---------------PVCRLCR--REGVKLYLKGERCSPKCAMERRPYP---PGQHGQKRARRPSDYAVR
1h3eA2          ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           RGFDRPRRENEDESKIFAKRPAFGGRGAYRERPKTDRSKTERRXXXXXXXXXXXGDRIAKVVARAGLCSR
1kskA4          ----------------------------------------------------------------------
1przA           ----------------------------------------------------------------------
1k8wA5          ----------------------------------------------------------------------
2apoA2          ----------------------------------------------------------------------
1v9kA           ----------------------------------------------------------------------
1ze2B2          ----------------------------------------------------------------------
1r3eA2          ----------------------------------------------------------------------
1vioA2          --------------------------------------------------------RLDKFIAENVGLTR
1jh3A           --------------------------------------------------------PLVELLVSAGISSK
1p9kA           --------------------------------------------------------ELCDLLKLEGWSSG
1kskA3          --------------------------------------------------------RLDKFIAQQLGVSR
1dm9A           --------------------------------------------------------RLDKWLWAARFYKT
1fjgD           LREKQKLRRIYGISERQFRN-------LFEEASKKKGVTGSV-------FLGLLESRLDNVVYRLGFASR
1h3eA2          --------------------------------------------------------WVARLFTLAGLTSN


                         *         .         .         .         .         +         .:560
query           RDAEAWIVEGRVAVNGRVIDSPALDVTYSDVITVDGKPLPERERTRLFLYHKPRGLMTTHADPEGRPTVF
1kskA4          ---------------------------------------------RYFXLNKPQG-YVCSTDDPDHPTVL
1przA           -------------------------------FEPQDIPLDIVEDEDIIVINKPRDLVVHPGAGNPDGTVL
1k8wA5          ------------------------------------------DINGVLLLDKPQGMSSNDALQKVKRIY-
2apoA2          -----------------IVKEEVETNWDYGCNPYERKIE-DLIKYGVVVVDKPRGPTSHEVSTWVKKILN
1v9kA           ----------------------------------------------ILVLNKPSGTAVHGGSGLSFGVIE
1ze2B2          ----------------------------------------------ILVAYKPKGPTSH--------DVV
1r3eA2          ----------------------------------------------ILVAYKPKGPTSH--------DVV
1vioA2          SQATKAIRQSAVKINGEIVKSGSVQISQEDEIYFEDELLT------------------------------
1jh3A           RQAREDIQNGAIYVNGERLQDVGAILTAEHRLEGRFTVIRRGKK-KYYLIRY------------------
1p9kA           AQAKIAIAEGQVKVDGAVETRKRCKIVAGQTVSFAGHSVQ------------------------------
1kskA3          AIAGREIRGNRVTVDGEIVRNAAFKLLPEHDVAYDGNPL-------------------------------
1dm9A           RAAREMIEGGKVHYNGQRSKPSKIVELNTLTLRQGNDERTVIVKAITEQRPASEAALLYEETAESVEKRE
1fjgD           RQARQLVRHGHITVNGRRVDLPSYRVRPGDEIAVAEKSRNKVGPWLSLDVEGMKGKFLRLPDREDLALPV
1h3eA2          AEARRLIQNRGLRLDGEVLTDPMLQVDLSRPRILQRGK--------------------------------


                         .         .         .         *         .         .         .:630
query           DNLPEDLPRLISIGRLDFNTEGLLLLTNDGGLARALELPETGWLRRYRVRAHGEVTQAQLDQLASGVEVD
1kskA4          YFLDEPVAKLHAAGRLDIDTTGLVLXTDDGQWSHRITSPRHHCEKTYLVTLESPVADDTAEQFAKGVQLH
1przA           NALLHYYPRAGIVHRLDKDTTGLXVVAKTVPAQTRLSLQRREITREYEAVAIGHXTAGGTVDEPISRHPT
1k8wA5          -----NANRAGHTGALDPLATGMLPICLGE--ATKFSQYLLDSDKRYRVIARLGQRTDTSDADGQIVEER
2apoA2          L------DKAGHGGTLDPKVTGVLPVALERATKTIPMWHIPP--KEYVCLMHLHRDASEEDILRVFKEFT
1v9kA           GLRALEARFLELVHRLDRDTSGVLLVAKKRSALRSLQLREKGXQKDYLALVRGQWQSHVKNILQSGERIV
1ze2B2          DEVRKKLKKVGHGGTLDPFACGVLIIGVNQ--GTRILEFYKDLKKVYGEYDQVPPAYSAKKYKGERLYKL
1r3eA2          DEVRKKLKKVGHGGTLDPFACGVLIIGVNQ--GTRILEFYKDLKKVYWVKMRLGLITETFDLAREGKIIN
1vioA2          ----------------------------------------------------------------------
1jh3A           ----------------------------------------------------------------------
1p9kA           ----------------------------------------------------------------------
1kskA3          ----------------------------------------------------------------------
1dm9A           KM--------------------------------------------------------------------
1fjgD           QEN-------------------------------------------------------------------
1h3eA2          ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           GVKYGPIEAKLERDQGANVWLVFAIREGKNREVRNVLAHLGLEVNRLIRVSYGPFQLLEIEEGQVEEVKT
1kskA4          NEKDLTKPAVLEV--ITPTQVRLTISEGRYHQVKRXFAAVGNHVVELHRERIGGITL-------------
1przA           KRTHXAVHPRIXEHFRVHTRLRLRLETGRTHQIRVHXAHITHPLVGDPVYGGRPRPPKGASEAFISTLR-
1k8wA5          PVTFSA----------EQLAAALDTFRGDIEQIPSMYSALKYQGKKLYEYARQGIEV-------------
2apoA2          GRIYQRRIRELELLDKDGKDVLFRVKCQSGTYIRKLCEDIGEALGELRRTKSGCFYLQDLLDAYVFWKED
1v9kA           RVSQEGKPSKVEERYAFATLVRCSPVTGRTHQIRVHTQYAGHPI--AFDDRYGDREF-------------
1ze2B2          AREGKIINLPPKRVEVSPGTYIRVRESVGPHTIEESLNV-FEAAPEEIENRIIPLEK-------------
1r3eA2          LPPKRVKIFKIWDVNIEGRDVSFRVEVSPGTYIRSLCMDIGYTAVELVRESVGPHTILNVFEAAPEEIEN
1vioA2          ----------------------------------------------------------------------
1jh3A           ----------------------------------------------------------------------
1p9kA           ----------------------------------------------------------------------
1kskA3          ----------------------------------------------------------------------
1dm9A           ----------------------------------------------------------------------
1fjgD           ----------------------------------------------------------------------
1h3eA2          ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           RVLREQLGEKIIKLAEAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1kskA4          ----------------------------------------------------------------------
1przA           ----------------------------------------------------------------------
1k8wA5          ----------------------------------------------------------------------
2apoA2          G-DEEELRRVIKPMEYG-----------------------------------------------------
1v9kA           ----------------------------------------------------------------------
1ze2B2          ----------------------------------------------------------------------
1r3eA2          RIIP------------------------------------------------------------------
1vioA2          ----------------------------------------------------------------------
1jh3A           ----------------------------------------------------------------------
1p9kA           ----------------------------------------------------------------------
1kskA3          ----------------------------------------------------------------------
1dm9A           ----------------------------------------------------------------------
1fjgD           ----------------------------------------------------------------------
1h3eA2          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           xxxxxxxxxxxxxxxxxxxxxxxxx
1kskA4          -------------------------
1przA           -------------------------
1k8wA5          -------------------------
2apoA2          -------------------------
1v9kA           -------------------------
1ze2B2          -------------------------
1r3eA2          -------------------------
1vioA2          -------------------------
1jh3A           -------------------------
1p9kA           -------------------------
1kskA3          -------------------------
1dm9A           -------------------------
1fjgD           -------------------------
1h3eA2          -------------------------