[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for rpal2:ABE38555.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3btaA3.bssp"

## Summary of PDB Search
:467
    9e-10  19%  3btaA3 [d.92.1.7] PROTEIN (BOTULINUM NEUROTOXIN TYPE A) A:1 -- 546
:467

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3btaA3          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3btaA3          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3btaA3          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxDIRWFRGDACFVFHV
3btaA3          -------------------------------------------------------DIAYIKIPNVGQMQP


                         .         *         .         .         .         .         +:350
query           MNAWEDGTKIVADVMQSEEAPLFTHPDGRRTDPEKGRARLCRWSFDLAGNTNAFKRSYLDDISGEFPRID
3btaA3          VKAFKIHNKIWVIPERDTF-TNPEEGDLNPPPEAKQVPVSYYDSTYL--STDNEKDNYLKGVTKLFERIY


                         .         .         .         .         *         .         .:420
query           Exxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3btaA3          S---------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3btaA3          -----------------------------------------------