[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for rpal2:ABE38586.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1ju3A2.bssp"
#ERROR : Can't open dsspfile "1hlgA.bssp"
#ERROR : Can't open dsspfile "1azwA.bssp"
#ERROR : Can't open dsspfile "2fukA1.bssp"
#ERROR : Can't open dsspfile "1cvlA.bssp"
#ERROR : Can't open dsspfile "1pjaA.bssp"
#ERROR : Can't open dsspfile "1mt3A.bssp"
#ERROR : Can't open dsspfile "1dwoA.bssp"
#ERROR : Can't open dsspfile "1ve6A2.bssp"
#ERROR : Can't open dsspfile "1jmkC.bssp"
#ERROR : Can't open dsspfile "1o5zA1.bssp"

## Summary of PDB Search
:586
    4e-14  11%  1ju3A2 [c.69.1.21] COCAINE ESTERASE A:5 -- 351
    5e-09  13%  1hlgA  [c.69.1.6] LIPASE, GASTRIC
    3e-06  10%  1azwA  [c.69.1.7] PROLINE IMINOPEPTIDASE
    5e-06  12%  2fukA1 [c.69.1.36] XC6422 PROTEIN A:3 -- 220
    7e-06  12%  1cvlA  [c.69.1.18] TRIACYLGLYCEROL HYDROLASE
    5e-05  12%  1pjaA  [c.69.1.13] PALMITOYL-PROTEIN THIOESTERASE 2 PRECURSOR
    2e-04  15%  1mt3A  [c.69.1.7] PROLINE IMINOPEPTIDASE
    2e-04   9%  1dwoA  [c.69.1.20] HYDROXYNITRILE LYASE
    2e-04  23%  1ve6A2 [c.69.1.33] ACYLAMINO-ACID-RELEASING ENZYME A:322 -- 581
    3e-04  20%  1jmkC  [c.69.1.22] SURFACTIN SYNTHETASE
    8e-04   7%  1o5zA1 [c.59.1.2] FOLYLPOLYGLUTAMATE SYNTHASE/DIHYDROFOLATE A:294
:586

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1ju3A2          ----------------------------------------------------------------------
1hlgA           ----------------------------------------------------------------------
1azwA           ----------------------------------------------------------------------
2fukA1          ----------------------------------------------------------------------
1cvlA           ----------------------------------------------------------------------
1pjaA           ----------------------------------------------------------------------
1mt3A           ----------------------------------------------------------------------
1dwoA           ----------------------------------------------------------------------
1ve6A2          ----------------------------------------------------------------------
1jmkC           ----------------------------------------------------------------------
1o5zA1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1ju3A2          ----------------------------------------------------------------------
1hlgA           ----------------------------------------------------------------------
1azwA           ----------------------------------------------------------------------
2fukA1          ----------------------------------------------------------------------
1cvlA           ----------------------------------------------------------------------
1pjaA           ----------------------------------------------------------------------
1mt3A           ----------------------------------------------------------------------
1dwoA           ----------------------------------------------------------------------
1ve6A2          ----------------------------------------------------------------------
1jmkC           ----------------------------------------------------------------------
1o5zA1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxDVAV
1ju3A2          ----------------------------------------------------------------------
1hlgA           ----------------------------------------------------------------------
1azwA           ----------------------------------------------------------------------
2fukA1          ------------------------------------------------------------------PTES
1cvlA           ----------------------------------------------------------------------
1pjaA           ----------------------------------------------------------------------
1mt3A           ----------------------------------------------------------------------
1dwoA           ----------------------------------------------------------------------
1ve6A2          ----------------------------------------------------------------------
1jmkC           ----------------------------------------------------------------------
1o5zA1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           TPGKVVYSNDLIELIQYAPATGEVRPEPILIVPAWIMKYYILDLSPHNSLVKYLTEQGFTVFMVSWRNPT
1ju3A2          -----------LAVDLYRPDADGPVP--VLLVRNPYDKFDVFAWSTQSTNWLEFVRDGYAVVIQDTRGLF
1hlgA           -------------RIPYGKKNSGQRPVVFLQHGLLASATNWISNLPNNSLAFILADAGYDVWLGNSRGNS
1azwA           --------------------------------------------------RRFHDPAKYRIVLFDQRGSG
2fukA1          AALTLDGPVGPLDVAVDLPEPDVAVQPVAIVCHPLSTEGGSMHNKVVTMAARALRELGITVVRFNFRSVG
1cvlA           ---------------------------PVILVHGLAGTDKFANVVDYYGIQSDLQSHGAKVYVANLSG--
1pjaA           -------------------------------------------------LLEYINETHPGTVVTVLDLFD
1mt3A           --------------------------------------------------LRDXTKEGITVLFYDQFSEE
1dwoA           ------------------PISKMVTA-HFVLIHTICH-----GAWIWHKLKPALERAGHKVTALDMAASG
1ve6A2          -----------------------------------------------DTFAASLAAAGFHVVMPNYRGST
1jmkC           ----------------------------------------------------------------------
1o5zA1          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           AKHRDLTLEDYRRLGVMAAIETIRAIVPHQPIHAVGYCLGGTLLSIAAAAMSRDGDDRLRSITLFAAQTD
1ju3A2          ASEGEFVPHVDDEADAEDTSWILEQAWCDGNVGMFGVSYLGVT----QWQAAVSGVGGLKAIAPSMASAD
1hlgA           VEFWAFSFDEMAKYDLPATIDFIVKKTGQKQLHYVGHSQGTTIGFIAFS----TNPSLAKRIKTFYALAP
1azwA           RSTPHADLVDNTTWDLVADIERLRTHLGVDRWQVFGGSWGSTLALAYAQTHPQQVTELVLRGIFLLRRFE
2fukA1          TSAGSFDHGDGEQDDLRAVAEWVRAQRPTDTLWLAGFSFGA-YVSLRAAAALEPQVLISIAPPAGRWDFS
1cvlA           --FQSDDGPNGRGEQLLAYVKQVLAATGATKVNLIGHSQGGLT----SRYVAAVAPQLVASVTTIGTPHR
1pjaA           GRESLR--PLWEQVQGFREAVVPIMAKAPQGVHLICYSQGG---LVCRALLSVMDDHNVDSFISLSSPQM
1mt3A           PDQSKFTIDYG-----VEEAEALRKLFGNEKVFLXGSSYGGAL----ALAYAVKYQDHLKGLIVSGGLSS
1dwoA           IDPRQIEQINSFDEYSEPLLTFLEKLPQGEKVIIVGESCAGLN----IAIAADRYVDKIAAGVFHNS---
1ve6A2          GYGEEWRLKIIGDPCVSAAARWARESGLASELYIMGYSYGGYMTLCALTM----KPGLFKAGVAGASVVD
1jmkC           -----------------RYADLIQKLQPEGPLTLFGYSAGC-SLAFEAAKKLEGQGRIVQRIIMVDS---
1o5zA1          --------------GAESLVRSLKLYFNGEPLSLVIGILDDKNREDILRKYTGIFERVI-------VTRV


                         .         .         .         .         *         .         .:420
query           FTEAGELTLFINESQVAFLEDMMWKRGVLDTTQMAGAFQILRSNDLVWSRMVRDYLMGERSEPNDLMAWN
1ju3A2          LYR---------APWYGPGGALSVEALLGWSALIGTGLITSRSDARPEDAADFVQLAAILNDVAGAASVT
1hlgA           VATVKYTKNKLRFVPQSLFKFIFGDKIFYPHNFFDQFLATEVCSREMLNLLCSNALFIICGFDSKNFNTS
1azwA           LEWFYQEGASRLFPDAWEHYLNAIPPVERADLMSAFHRRLTSDDEATRLAAAKAWSVWEGATSFLHVDED
2fukA1          DVQPPAQWLVIQGDADEIVDPQAVYD--------------------------------------------
1cvlA           GSEFADF---------------------------------------------------------------
1pjaA           GQYG--------DTDYLKWLFPTSMRSNLYRICYSPWGQEFSICNYWHDPHHDDLYLNASSFLALINGER
1mt3A           VLTVKEXNRLIDELPAKYRDAIYGSSGSYENPEYQEAVNYFY-----HQHLLRSEDWPPEVLKSLEYAER
1dwoA           -----------------LLPDTVHSPSYTVEKLLESFPDWRDTEYFTFTNITGETITTMKLGFVLLRENL
1ve6A2          WEEMYELS--------------------------------------------------------------
1jmkC           ----------------------------------------------------------------------
1o5zA1          PSPRMKDMNSLVDMAKKFFKNV------------------------------------------------


                         .         .         +         .         .         .         .:490
query           ADATRMPYRMHSEYLRKLFLDNDLAEGRYTVDDRAIALSDIHTPMFVVGTLRDHVAPWRSTFKIHLLADA
1ju3A2          PLAEQPLLGRLIPWVIDQVVDHPDNDESWQSISLFERLGGLATPALITAGWYDGFVGESLRTFVAVKDNA
1hlgA           RLDVYLSHNPAGTSVQNMFHWTQNRMHYDQSQPPYYNVTAMNVPIAVWNGGKDLLADPQDVGLLLKLPNL
1azwA           FVTGHEDAHFALAFARENHYFVNGGFFEVEDQLLRDAHRIADIPGVIVHGRYDVVCPLQSAWDLHKAWPK
2fukA1          ----------------------------------------------------------------------
1cvlA           ----------------------------------------------------------------------
1pjaA           DHPNATVWRKNFLRVGHLVLIGGPDDGVITPWQSSFFGFYDANETVLEMEEQLVYLRDSFGLKTLLARGA
1mt3A           RNVYRIXNGPNEFTITGTIKDWDITD----------KISAIKIPTLITVGEYDEVTPNVARVIHEKIAGS
1dwoA           FTKCTDGEY---ELAKMVMRKGSLFQNVLAQRPKFTEKGYGSIKKVYIWTDQDKIFLPDFQRWQIANYKP
1ve6A2          ----------------------------------------------------------------------
1jmkC           ----------------------------------------------------------------------
1o5zA1          ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           EITFCLTGGGHNAGIVSPPSPKAHGYQVMMKEADGPYIGPDDWIKEAPHAEGSWWTEWVHWLEARSGQPV
1ju3A2          DARLVVGPWSHSNLTGRN-------------ADRKFGIAATYPIQEATTMHKAFFDRHLRGETDALAGVP
1hlgA           IYHKEIPFYNHLDFIWAMDAPQE-----------------------------------------------
1azwA           AQLQISPASGHSAFEPEN----------------------------------------------------
2fukA1          ----------------------------------------------------------------------
1cvlA           ----------------------------------------------------------------------
1pjaA           IVRCPMAGISHTA---------------------------------------------------------
1mt3A           ELHV-FRDCSHLTXW-------------------------------------------------------
1dwoA           DKVYQVQGGDH-----------------------------------------------------------
1ve6A2          ----------------------------------------------------------------------
1jmkC           ----------------------------------------------------------------------
1o5zA1          ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           Pxxxxxxxxxxxxxxxxxxxxxxxxx
1ju3A2          K-------------------------
1hlgA           --------------------------
1azwA           --------------------------
2fukA1          --------------------------
1cvlA           --------------------------
1pjaA           --------------------------
1mt3A           --------------------------
1dwoA           --------------------------
1ve6A2          --------------------------
1jmkC           --------------------------
1o5zA1          --------------------------