[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for rpal2:ABE38614.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2r6gG1.bssp"
#ERROR : Can't open dsspfile "2r6gF2.bssp"
#ERROR : Can't open dsspfile "2onkC1.bssp"
#ERROR : Can't open dsspfile "3dhwA1.bssp"
#ERROR : Can't open dsspfile "1tluA.bssp"

## Summary of PDB Search
:287
    5e-21  19%  2r6gG1 [f.58.1.1] MALTOSE TRANSPORT SYSTEM PERMEASE PROTEIN MALG
    4e-20  19%  2r6gF2 [f.58.1.1] MALTOSE TRANSPORT SYSTEM PERMEASE PROTEIN MALF
    3e-19  30%  2onkC1 [f.58.1.1] MOLYBDATE/TUNGSTATE ABC TRANSPORTER, PERMEASE C:1
    1e-14  14%  3dhwA1 [f.58.1.1] D-METHIONINE TRANSPORT SYSTEM PERMEASE PROTEIN
    6e-09  14%  1tluA  [d.156.1.2] S-ADENOSYLMETHIONINE DECARBOXYLASE PROENZYME,
:287

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxRFIVLSVVAVVTLFILIAPLAVILSSAFAQGVGVFLRNLGDPGTLHAM
2r6gG1          --------------------------------------------------------------PFPVLLWL
2r6gF2          -------------------------------------------------------VFTDEGIQKPFLAIF
2onkC1          ----------------------RLLFSALLALLSSIILLFVLLPVAATVTLQLFNFFLKAASDPAVWKVV
3dhwA1          ---------------------------------------------------------------WLLVRGV
1tluA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           WLTTITALIAVPINILFGVAAAWTVTKFEFPGRTLLIALIELPYSISPIVAGVAYLFVYGSQGLFGPLLD
2r6gG1          WNSVKVAGISAIGIVALSTTCAYAFARMRFPGKATLLKGMLIFQMFPAVLSLVALYALFDRLGEYIPFI-
2r6gF2          VWTVVFSLITVFLTVAVGMVLACLVQWEALRGKAVYRVLLILPYAVPSFISILIFKGLFNQSFGEINMML
2onkC1          LTTYYAALISTLIAVIFGTPLAYILARKSFPGKSVVEGIVDLPVVIPHTVAGIALLVVFGSSGLIGSFSP
3dhwA1          WETLAMTFVSGFFGFVIGLPVGVLLYVTRPGQIIANAKLYRTVSAIVNIFRSIPFIILLVWMIPFTRVI-
1tluA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           QLDLKVMFALPGIVLASMFVTAPYVARELIPLMQVQGTDEEEAAVTLGAGGFATFFRVTLPNIRWAMLYG
2r6gG1          ------GLNTHGGVIFAYLGGIALHVWTIKGYFETIDSSLEEAAALDGATPWQAFRLVLLPLSVPILAVV
2r6gF2          SAFSDPTTARTMLIIVNTWLGYPYMMILCMGLLKAIPDDLYEASAMDGAGPFQNFFKITLPLLIKPLTPL
2onkC1          LKFV---DALPGIVVAMLFVSVPIYINQAKEGFASVDVRLEHVARTLGSSPLRVFFTVSLPLSVRHIVAG
3dhwA1          ---VGTSIGLQAAIVPLTVGAAPFIARMVENALLEIPTGLIEASRAMGATPMQIVRKVLLPEALPGLVNA
1tluA           ------------SLGRHLVAEFYECDREVLDNVQLIEQEMKQAAYESGATIVTSTFHRFLPYGVSGVVVI


                         .         .         .         +         .         .         .:280
query           AILCNARVLGEFGAVSVVSGNVRGQTTTLPLQIELLYQDYNxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2r6gG1          FILSFIAAITEVPVASLLLRDVNSYTLAVGMQQYLNPQNYL-----------------------------
2r6gF2          MIASFAFNFNNFVLIQLLTNGGPDRLGTTTPAG-------------------------------------
2onkC1          AIMSWARGISEFGAVVVIAYY--PMIAPTLIYERYLSEGLS-----------------------------
3dhwA1          ATI-------------------------------------------------------------------
1tluA           SESLTIHTWPEYGYAAIDLFTCGEDVDPWKAFEHLKKA--------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxx
2r6gG1          -------
2r6gF2          -------
2onkC1          -------
3dhwA1          -------
1tluA           -------