[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for rpal2:ABE38720.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1zswA1.bssp"
#ERROR : Can't open dsspfile "1f9zA.bssp"
#ERROR : Can't open dsspfile "1sp9A.bssp"
#ERROR : Can't open dsspfile "1mpyA2.bssp"
#ERROR : Can't open dsspfile "1twuA.bssp"
#ERROR : Can't open dsspfile "1zswA2.bssp"
#ERROR : Can't open dsspfile "1cjxA1.bssp"
#ERROR : Can't open dsspfile "1bylA.bssp"
#ERROR : Can't open dsspfile "1dhyA2.bssp"
#ERROR : Can't open dsspfile "1u6lA.bssp"
#ERROR : Can't open dsspfile "1r9cA.bssp"
#ERROR : Can't open dsspfile "1bh5A.bssp"
#ERROR : Can't open dsspfile "1jc4A.bssp"
#ERROR : Can't open dsspfile "1mpyA1.bssp"
#ERROR : Can't open dsspfile "1f1rA1.bssp"
#ERROR : Can't open dsspfile "1sqiA1.bssp"
#ERROR : Can't open dsspfile "1xqaA.bssp"
#ERROR : Can't open dsspfile "1kllA.bssp"
#ERROR : Can't open dsspfile "1tsjA.bssp"
#ERROR : Can't open dsspfile "2pjsA1.bssp"
#ERROR : Can't open dsspfile "1ss4A.bssp"
#ERROR : Can't open dsspfile "1lqkA.bssp"
#ERROR : Can't open dsspfile "1cjxA2.bssp"
#ERROR : Can't open dsspfile "1ecsA.bssp"
#ERROR : Can't open dsspfile "1sp8A1.bssp"
#ERROR : Can't open dsspfile "1f1rA2.bssp"
#ERROR : Can't open dsspfile "2i7rA1.bssp"

## Summary of PDB Search
:180
    3e-17  22%  1zswA1 [d.32.1.10] GLYOXALASE FAMILY PROTEIN A:1 -- 144
    1e-16  22%  1f9zA  [d.32.1.1] GLYOXALASE I
    1e-16  10%  1sp9A  [d.32.1.3] 4-HYDROXYPHENYLPYRUVATE DIOXYGENASE
    6e-16  28%  1mpyA2 [d.32.1.3] CATECHOL 2,3-DIOXYGENASE A:146 -- 307
    9e-16  11%  1twuA  [d.32.1.8] HYPOTHETICAL PROTEIN YYCE
    1e-15  21%  1zswA2 [d.32.1.10] GLYOXALASE FAMILY PROTEIN A:145 -- 314
    3e-15  13%  1cjxA1 [d.32.1.3] 4-HYDROXYPHENYLPYRUVATE DIOXYGENASE A:4 -- 153
    3e-15   9%  1bylA  [d.32.1.2] PROTEIN (BLEOMYCIN RESISTANCE PROTEIN)
    8e-15  24%  1dhyA2 [d.32.1.3] 2,3-DIHYDROXYBIPHENYL 1,2-DIOXYGENASE A:133 --
    2e-14  16%  1u6lA  [d.32.1.7] HYPOTHETICAL PROTEIN
    2e-14  17%  1r9cA  [d.32.1.2] GLUTATHIONE TRANSFERASE
    2e-14  20%  1bh5A  [d.32.1.1] LACTOYLGLUTATHIONE LYASE
    2e-14  16%  1jc4A  [d.32.1.4] METHYLMALONYL-COA EPIMERASE
    4e-14  15%  1mpyA1 [d.32.1.3] CATECHOL 2,3-DIOXYGENASE A:1 -- 145
    2e-13  14%  1f1rA1 [d.32.1.3] HOMOPROTOCATECHUATE 2,3-DIOXYGENASE A:3 -- 147
    2e-13  26%  1sqiA1 [d.32.1.3] 4-HYDROXYPHENYLPYRUVIC ACID DIOXYGENASE A:8 --
    4e-13  19%  1xqaA  [d.32.1.2] GLYOXALASE/BLEOMYCIN RESISTANCE PROTEIN
    6e-13  11%  1kllA  [d.32.1.2] MITOMYCIN-BINDING PROTEIN
    6e-13  11%  1tsjA  [d.32.1.7] CONSERVED HYPOTHETICAL PROTEIN
    6e-13  15%  2pjsA1 [d.32.1.2] UNCHARACTERIZED PROTEIN ATU1953 A:3 -- 113
    2e-12  14%  1ss4A  [d.32.1.6] GLYOXALASE FAMILY PROTEIN
    2e-11  22%  1lqkA  [d.32.1.2] PROBABLE FOSFOMYCIN RESISTANCE PROTEIN
    6e-11  10%  1cjxA2 [d.32.1.3] 4-HYDROXYPHENYLPYRUVATE DIOXYGENASE A:154 -- 356
    2e-10  14%  1ecsA  [d.32.1.2] BLEOMYCIN RESISTANCE PROTEIN
    4e-08  25%  1sp8A1 [d.32.1.3] 4-HYDROXYPHENYLPYRUVATE DIOXYGENASE A:36 -- 207
    4e-07  14%  1f1rA2 [d.32.1.3] HOMOPROTOCATECHUATE 2,3-DIOXYGENASE A:148 -- 323
    3e-04  20%  2i7rA1 [d.32.1.2] CONSERVED DOMAIN PROTEIN A:1 -- 115
:180

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MQIQQIHHVAYRCKDAKQTVEFYGRVMGMDLIGAIAEDKVPSTKAPDPYMHIFLDAGAGNILAFFELPNS
1zswA1          YEIKGHHHISMVTKNANENNHFYKNVLGLRRV------KMTVNQDDPSMYHLFYGDKTGSPGTELSFFEI
1f9zA           ----RLLHTMLRVGDLQRSIDFYTKVLGMKLLRTSENP-------EYKYSLAFVGYGPETEEAVIELTYN
1sp9A           YGIRRLDHAVGNVPELGPALTYVAGFTGFHQFASGLNSAVLASNDEMVLLPINEPVHGTKRKSQIQTYLE
1mpyA2          -------HALMYGDELPATYDLFTKVLGFYLAEQV------------------LDENGTRVAQFLSLSTK
1twuA           --QAAQIRIARPTGQLDEIIRFYEEGLCLKR--------IGEFSQHNGYDGVMFGLPHADYHLEFTQYEG
1zswA2          -QIQGMGSVELTVRRLDKMASTLTEIFGYTEVSRNDQEAIFQSIKGE--------AFGEIVVKYLDGP-T
1cjxA1          MGLMGFEFIEFASPTPGTLEPIFEIMGFTKV-------------ATHRSKNVHLYRQGEINLILNNEPNS
1bylA           MAKLTSAVPVLTARDVAGAVEFWTDRLGFSRD--------------FVEDDFAGVVRDDVTLFISAVQDQ
1dhyA2          TGDQGIGHFVRCVPDTAKAMAFYTEVLGF----------VLSDIIDIVPAHFLHCNGRHHTIALAAFPIP
1u6lA           ---LQIVPYLIFNGNCREAFSCYHQHLGGTLE-----AXLPFGDSPEPADWKDKIXHARLVVGSFALXAS
1r9cA           --IEGLSHMTFIVRDLERMTRILEGVFDAREVYASDTE-------QFSLSREKFFLIGDIWVAIMQGEKL
1bh5A           TKDFLLQETMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSLYKDEKIAWALSRKATLELTHNWGTED
1jc4A           DLFICIDHVAYACPDADEASKYYQETFGWHELHREENPEQGVVEIXXAPAAKLTEHXTQVQVXAPLNDES
1mpyA1          --VMRPGHVQLRVLDMSKALEHYVELLGLIEM-----------DRDDQGRVYLKAWTEVDKFSLVLREAD
1f1rA1          PDIVRCAYMEIVVTDLAKSREFYVDVLGLHVT------------EEDENTIYLRSLEEFIHHNLVLRQGP
1sqiA1          --FLHFHSVTFWVGNAKQAASFYCNKMGFEPL----AYKGLETGSRE---VVSHVIKQGKIVFVLCSALN
1xqaA           -----IKHLNLTVADVVAAREFLEKYFGLTCS-------------GTRGNAFAVXRDNDGFILTLXKG--
1kllA           ----RISLFAVVVEDXAKSXEFYRKXGVEIPAEADSAPHTEAVLDGGIRLAWDT-------VETVRSYDP
1tsjA           MDIPKITTFLXFNNQAEEAVKLYTSLFEDSEII-------------------TXAKYGDPGTVQHSIFTL
2pjsA1          ----RRVVANIATPEPARAQAFYGDILGXPVA-----------XDHGWIVTHASPLEAHAQVSFAR----
1ss4A           -KLLRXDNVSIVVESLDNAISFFEEIGLNLEGRANVEGEVTGLGSQCVEIAXXVTPDGHSRIELSRFLTP
1lqkA           --LTGLNHLTLAVADLPASIAFYRDLLGFR----------LEARWDQG---AYLELG-SLWLCLSREPQY
1cjxA2          --LKVIDHLTHNVYRMVYWANFYEKLFNFREARYFDIKGEYTGL----TSKAMSAPDGMIRIPLNEESSK
1ecsA           ----DQATPNLPSRDFDSTAAFY-ERLGF-------------GIVFRDAGWMILQRGDLMLEFFAHPGLD
1sp8A1          FHTLAFHHVELWCADAASAAGRFSFGLGAPLA--------------------------------------
1f1rA2          -ELVRLDHFNQVTPDVPRGRAYLEDLGFRVSEDIKDS--------DGVTYAAWMHRKQTVHDTALTGGNG
2i7rA1          --------------NVPQVCADLEHILDK-----------KADYANDGFAQF---TIGSHCLXLSQNHLV


                         .         .         *         .         .         .         .:140
query           PPMGRDPNTPDWTQHIAFQVENIDALLSAKQRAEANGLDVVGPTDHTIFKSIYFWDPSGHRLEVAAWTAT
1zswA1          PLVGRTYRGTNAITRIGLLVPSEDSLHYWKERFEKFDVKHSEMTTYANRPALQFEDAEGLRLVLLV----
1f9zA           WGVDKYEL-GTAYGHIALSVDNAAEACEKIRQNGGNVTREAGPVKGGTTVIAFVEDPDGYKIELIE----
1sp9A           HNEGA------GLQHLALMSEDIFRTL---REMRKRSSIGGFDFPPTYYQNLKKRVGDVLSDDQIKECEE
1mpyA2          AHDIHHPEKG-RLHHVSFHLETWEDLLRAADLISMTDTSIIGPTRHGLGKTIYFFDPSGNRNEVFC----
1twuA           GSTAPVPHPDSLLVFYVPNAVELAAIT---SKLKHMGYQEVSENPYWSNGGVTIEDPDGWRIVFMN----
1zswA2          EKPGRGS-----IHHLAIRVKNDAELAYWEEQVKQRGFHSSGIIDRFYFKSLYFRESNGILFEIAT----
1cjxA1          IASYFAAEHGPSVCGMAFRVKDSQKAY---NRALELGAQPIHDTGPMELNLPAIKGIGGAPLYLID----
1bylA           VVPDNTLAWVWVRGLDELYAEWSEVVS---TNFRDASGPAMEIGEQPWGREFALRDPAGNCVHF------
1dhyA2          K----------RIHHFMLQANTIDDVGYAFDRLDAAGRITSLLGRHDQTLSFYADTPSPMIEVEFGW---
1u6lA           DNHPAYPYEGIKGCSISLNVDSKAEAERLFNALAEGGSVQXPLGPTWAASFGXFTDRFGVAWXV------
1r9cA           AERS------YNHIAFKIDDADFDRYA---ERVGKLGLDMRPPRPG---RSIYFYDDDNHMFELHTGTLT
1bh5A           DETQSYHNGNSDPRGFGHIGIAVPDVYSACKRFEELGVKFVKPDDGKMKGLAFIQDPDGYWIQILNP---
1jc4A           TVAKAKHNGRAGLHHXAWRVDDIDAVSATLRERGVQLLYDEPGTGGNRINFXHPKSGKGVLIEL------
1mpyA1          EPGMD------FMGFKVVDEDALRQLERDLMAYGCAVEQLPAGELNSCGRRVRFQAPSGHHFELYA----
1f1rA1          IA------AVAAFAYRVKSPAEVDAAEAYYKELGCRTERRKEGFTKGIGDSVRVEDPLGFPYEFFY----
1sqiA1          PEMGDHLKHGDGVKDIAFEVEDCEH---IVQKARERGAKIVRE---------------------------
1xqaA           -----KEVQYPKTFHVGFPQESEEQVDKINQRLKEDGFLVEPPKHA--AYTFYVEAPGGFTIEV------
1kllA           EWQAPTGGHRFAIAFEFPDTASVDK---KYAELVDAGYEGHLKPWNAVWRYAIVKDPDGNVVDLFAP---
1tsjA           NGQ---VFXAIDPISLFVTVKDTIEXERLFNGLKDEGAILXPKTNPPYREFAWVQDKFGVSFQLAL----
2pjsA1          -----EGGSGTDVPDLSIEVDNFDEVH---ARILKAGLPIEYGTEAWGVQRLFLRDPFGKLINI------
1ss4A           PTIATAPVNALGYLRVXFTVEDIDEXV---SRLTKHGAELVGEQYENSYRLCYIRGVEGILIGLAE----
1lqkA           GGPAA------DYTHYAFGIAAAD-FARFAAQLRAHGVR-EWKQNRSEGDSFYFLDPDGHRLEAHVGD--
1cjxA2          GAGQLMQFNGEGIQHVAFLTDDLVKTW---DALKKIGMRFMTAPPDTYYLEGRLPDHGEPVDQLQA----
1ecsA           PLASWF--------SCCLRLDDLAECKSVGIQETSSGYPRIHAPELQGWTMAALVDPDGTLLRLIQ----
1sp8A1          ----------------------------------------------------------------------
1f1rA2          PRM----------HHVAFATHEKHNIIQICDKMGALRISDPGRHGVSNAFYLYILDPDGHRIEIYTQDYY
2i7rA1          PLENFQSG-----IIIHIEVEDVDQNY---KRLNELGIKVLGPTVTDWTESLLVQGPAGLVLD-------


                         +         .         .         .         .         *         .:210
query           PQQLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1zswA1          ----------------------------------------
1f9zA           ----------------------------------------
1sp9A           LGIL------------------------------------
1mpyA2          ----------------------------------------
1twuA           ----------------------------------------
1zswA2          ----------------------------------------
1cjxA1          ----------------------------------------
1bylA           ----------------------------------------
1dhyA2          ----------------------------------------
1u6lA           ----------------------------------------
1r9cA           ER--------------------------------------
1bh5A           ----------------------------------------
1jc4A           ----------------------------------------
1mpyA1          ----------------------------------------
1f1rA1          ----------------------------------------
1sqiA1          ----------------------------------------
1xqaA           ----------------------------------------
1kllA           ----------------------------------------
1tsjA           ----------------------------------------
2pjsA1          ----------------------------------------
1ss4A           ----------------------------------------
1lqkA           ----------------------------------------
1cjxA2          ----------------------------------------
1ecsA           ----------------------------------------
1sp8A1          ----------------------------------------
1f1rA2          T---------------------------------------
2i7rA1          ----------------------------------------