[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for rpal2:ABE38755.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1b0uA.bssp"
#ERROR : Can't open dsspfile "1ji0A.bssp"
#ERROR : Can't open dsspfile "1q3hA.bssp"
#ERROR : Can't open dsspfile "1l7vC.bssp"
#ERROR : Can't open dsspfile "1sgwA.bssp"
#ERROR : Can't open dsspfile "1e69A.bssp"
#ERROR : Can't open dsspfile "1pf4A1.bssp"
#ERROR : Can't open dsspfile "1m3eA1.bssp"
#ERROR : Can't open dsspfile "1ex6A.bssp"
#ERROR : Can't open dsspfile "1g6hA.bssp"
#ERROR : Can't open dsspfile "1e9rA.bssp"
#ERROR : Can't open dsspfile "1nijA1.bssp"
#ERROR : Can't open dsspfile "1bmfA3.bssp"
#ERROR : Can't open dsspfile "1mukA.bssp"
#ERROR : Can't open dsspfile "1t06A.bssp"
#ERROR : Can't open dsspfile "2gx8A1.bssp"
#ERROR : Can't open dsspfile "1pv4A3.bssp"
#ERROR : Can't open dsspfile "1bgxT2.bssp"
#ERROR : Can't open dsspfile "1khbA1.bssp"
#ERROR : Can't open dsspfile "2iqhA1.bssp"
#ERROR : Can't open dsspfile "1vplA.bssp"
#ERROR : Can't open dsspfile "1qhlA.bssp"
#ERROR : Can't open dsspfile "1mjgM.bssp"
#ERROR : Can't open dsspfile "1c4oA1.bssp"
#ERROR : Can't open dsspfile "1n25A.bssp"
#ERROR : Can't open dsspfile "1ffhA2.bssp"
#ERROR : Can't open dsspfile "1zp6A1.bssp"
#ERROR : Can't open dsspfile "1urjA.bssp"
#ERROR : Can't open dsspfile "1kgdA.bssp"
#ERROR : Can't open dsspfile "1jjvA.bssp"
#ERROR : Can't open dsspfile "1jalA1.bssp"
#ERROR : Can't open dsspfile "2yyeA2.bssp"
#ERROR : Can't open dsspfile "1e6cA.bssp"
#ERROR : Can't open dsspfile "1udwA.bssp"
#ERROR : Can't open dsspfile "1cd5A.bssp"
#ERROR : Can't open dsspfile "1afrA.bssp"
#ERROR : Can't open dsspfile "2v3jA1.bssp"
#ERROR : Can't open dsspfile "1d6jA.bssp"
#ERROR : Can't open dsspfile "1atrA1.bssp"
#ERROR : Can't open dsspfile "1s9hA.bssp"
#ERROR : Can't open dsspfile "1f2t.1.bssp"
#ERROR : Can't open dsspfile "1xbtA1.bssp"
#ERROR : Can't open dsspfile "2axpA1.bssp"
#ERROR : Can't open dsspfile "1fl9A.bssp"
#ERROR : Can't open dsspfile "1t3wA.bssp"
#ERROR : Can't open dsspfile "1jb1A.bssp"
#ERROR : Can't open dsspfile "1f46A.bssp"
#ERROR : Can't open dsspfile "1bs2A1.bssp"
#ERROR : Can't open dsspfile "1g6oA.bssp"
#ERROR : Can't open dsspfile "1dhyA1.bssp"
#ERROR : Can't open dsspfile "1e3mA2.bssp"
#ERROR : Can't open dsspfile "1vhhA.bssp"
#ERROR : Can't open dsspfile "1i1qA.bssp"
#ERROR : Can't open dsspfile "1tljA.bssp"
#ERROR : Can't open dsspfile "2vgmA3.bssp"
#ERROR : Can't open dsspfile "1dnpA2.bssp"
#ERROR : Can't open dsspfile "1zs3A1.bssp"
#ERROR : Can't open dsspfile "1tmkA.bssp"
#ERROR : Can't open dsspfile "1mm8A.bssp"
#ERROR : Can't open dsspfile "1ak2A1.bssp"
#ERROR : Can't open dsspfile "1g8yA.bssp"
#ERROR : Can't open dsspfile "1cr0A.bssp"
#ERROR : Can't open dsspfile "1j1zA2.bssp"
#ERROR : Can't open dsspfile "1ohcA1.bssp"
#ERROR : Can't open dsspfile "1grqA.bssp"
#ERROR : Can't open dsspfile "2qgmA1.bssp"
#ERROR : Can't open dsspfile "1rkbA.bssp"
#ERROR : Can't open dsspfile "2vnuD1.bssp"
#ERROR : Can't open dsspfile "1ni3A1.bssp"
#ERROR : Can't open dsspfile "1v47A1.bssp"
#ERROR : Can't open dsspfile "1l3aA.bssp"
#ERROR : Can't open dsspfile "1poiA.bssp"
#ERROR : Can't open dsspfile "2pa7A1.bssp"
#ERROR : Can't open dsspfile "1ii8.1.bssp"
#ERROR : Can't open dsspfile "1qhdA1.bssp"
#ERROR : Can't open dsspfile "2gk3A1.bssp"
#ERROR : Can't open dsspfile "1jbkA.bssp"
#ERROR : Can't open dsspfile "3cddA1.bssp"
#ERROR : Can't open dsspfile "1mi8A.bssp"
#ERROR : Can't open dsspfile "1ovmA2.bssp"
#ERROR : Can't open dsspfile "1b77A2.bssp"
#ERROR : Can't open dsspfile "1em8A.bssp"
#ERROR : Can't open dsspfile "1sbxA.bssp"
#ERROR : Can't open dsspfile "1np6A.bssp"
#ERROR : Can't open dsspfile "2gtlM1.bssp"
#ERROR : Can't open dsspfile "3cddA2.bssp"
#ERROR : Can't open dsspfile "1viaA.bssp"
#ERROR : Can't open dsspfile "2ancF1.bssp"
#ERROR : Can't open dsspfile "1ckvA.bssp"
#ERROR : Can't open dsspfile "1yr6A1.bssp"
#ERROR : Can't open dsspfile "1iqrA2.bssp"
#ERROR : Can't open dsspfile "1lw7A2.bssp"
#ERROR : Can't open dsspfile "2fggA1.bssp"
#ERROR : Can't open dsspfile "2je6I3.bssp"
#ERROR : Can't open dsspfile "1uouA3.bssp"
#ERROR : Can't open dsspfile "1es6A2.bssp"
#ERROR : Can't open dsspfile "1f8xA.bssp"
#ERROR : Can't open dsspfile "1l7lA.bssp"
#ERROR : Can't open dsspfile "2f9hA1.bssp"
#ERROR : Can't open dsspfile "1yj5A2.bssp"
#ERROR : Can't open dsspfile "1g8fA3.bssp"
#ERROR : Can't open dsspfile "1yvuA2.bssp"
#ERROR : Can't open dsspfile "1dwmA.bssp"
#ERROR : Can't open dsspfile "1xl3C1.bssp"
#ERROR : Can't open dsspfile "1g31A.bssp"
#ERROR : Can't open dsspfile "1a4iA2.bssp"
#ERROR : Can't open dsspfile "2gujA1.bssp"
#ERROR : Can't open dsspfile "1oa8A.bssp"
#ERROR : Can't open dsspfile "1bccF.bssp"
#ERROR : Can't open dsspfile "1zbsA1.bssp"
#ERROR : Can't open dsspfile "1jqjA3.bssp"
#ERROR : Can't open dsspfile "1tueA.bssp"
#ERROR : Can't open dsspfile "1o7d.2.bssp"
#ERROR : Can't open dsspfile "1esmA.bssp"
#ERROR : Can't open dsspfile "1d8jA.bssp"
#ERROR : Can't open dsspfile "1j90A.bssp"
#ERROR : Can't open dsspfile "1gm5A1.bssp"
#ERROR : Can't open dsspfile "1e2hA.bssp"
#ERROR : Can't open dsspfile "1q3tA.bssp"
#ERROR : Can't open dsspfile "1v37A.bssp"
#ERROR : Can't open dsspfile "1l1oA.bssp"
#ERROR : Can't open dsspfile "1puoA2.bssp"
#ERROR : Can't open dsspfile "1t9hA2.bssp"
#ERROR : Can't open dsspfile "1odfA.bssp"
#ERROR : Can't open dsspfile "1w1wA.bssp"
#ERROR : Can't open dsspfile "1tf7A1.bssp"
#ERROR : Can't open dsspfile "1pgsA2.bssp"
#ERROR : Can't open dsspfile "1xkpA1.bssp"
#ERROR : Can't open dsspfile "1iioA.bssp"

## Summary of PDB Search
:253
    4e-45  26%  1b0uA  [c.37.1.12] HISTIDINE PERMEASE
    6e-45  30%  1ji0A  [c.37.1.12] ABC TRANSPORTER
    1e-36  16%  1q3hA  [c.37.1.12] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-35  22%  1l7vC  [c.37.1.12] VITAMIN B12 TRANSPORT ATP-BINDING PROTEIN BTUD
    1e-34  19%  1sgwA  [c.37.1.12] PUTATIVE ABC TRANSPORTER
    7e-31  13%  1e69A  [c.37.1.12] CHROMOSOME SEGREGATION SMC PROTEIN
    9e-30  24%  1pf4A1 [c.37.1.12] TRANSPORT ATP-BINDING PROTEIN MSBA A:321 -- 564
    2e-29   8%  1m3eA1 [c.124.1.2] SUCCINYL-COA:3-KETOACID-COENZYME A TRANSFERASE
    5e-27  13%  1ex6A  [c.37.1.1] GUANYLATE KINASE
    6e-27  32%  1g6hA  [c.37.1.12] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID
    1e-24   9%  1e9rA  [c.37.1.11] CONJUGAL TRANSFER PROTEIN TRWB
    1e-24  12%  1nijA1 [c.37.1.10] HYPOTHETICAL PROTEIN YJIA A:2 -- 223
    5e-24   9%  1bmfA3 [c.37.1.11] BOVINE MITOCHONDRIAL F1-ATPASE A:95 -- 379
    4e-23  13%  1mukA  [e.8.1.4] MINOR CORE PROTEIN LAMBDA 3
    9e-23   8%  1t06A  [a.118.1.17] HYPOTHETICAL PROTEIN
    4e-22  10%  2gx8A1 [c.135.1.1] NIF3-RELATED PROTEIN A:4 -- 373
    1e-21  12%  1pv4A3 [c.37.1.11] TRANSCRIPTION TERMINATION FACTOR RHO A:129 --
    3e-21  15%  1bgxT2 [c.120.1.2] TAQ DNA POLYMERASE T:1 -- 173
    3e-21   7%  1khbA1 [c.91.1.1] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    9e-21   9%  2iqhA1 [e.75.1.1] NUCLEOCAPSID PROTEIN A:21 -- 489
    1e-20  24%  1vplA  [c.37.1.12] ABC TRANSPORTER, ATP-BINDING PROTEIN
    1e-20  12%  1qhlA  [c.37.1.12] PROTEIN (CELL DIVISION PROTEIN MUKB)
    3e-20   8%  1mjgM  [e.26.1.3] CARBON MONOXIDE DEHYDROGENASE ALPHA SUBUNIT
    1e-19  11%  1c4oA1 [c.37.1.19] DNA NUCLEOTIDE EXCISION REPAIR ENZYME UVRB A:2
    1e-19   7%  1n25A  [c.37.1.20] LARGE T ANTIGEN
    2e-19  12%  1ffhA2 [c.37.1.10] FFH A:89 -- 295
    3e-19  10%  1zp6A1 [c.37.1.25] HYPOTHETICAL PROTEIN ATU3015 A:6 -- 181
    3e-19  13%  1urjA  [e.58.1.1] MAJOR DNA-BINDING PROTEIN
    4e-19   5%  1kgdA  [c.37.1.1] PERIPHERAL PLASMA MEMBRANE CASK
    4e-19  10%  1jjvA  [c.37.1.1] DEPHOSPHO-COA KINASE
    6e-19  13%  1jalA1 [c.37.1.8] YCHF PROTEIN A:1 -- 278
    9e-19   8%  2yyeA2 [d.139.1.1] SELENIDE, WATER DIKINASE A:155 -- 336
    2e-18  11%  1e6cA  [c.37.1.2] SHIKIMATE KINASE
    7e-18   8%  1udwA  [c.37.1.6] URIDINE-CYTIDINE KINASE 2
    1e-17  12%  1cd5A  [c.124.1.1] PROTEIN (GLUCOSAMINE 6-PHOSPHATE DEAMINASE)
    2e-17   7%  1afrA  [a.25.1.2] DELTA9 STEAROYL-ACYL CARRIER PROTEIN DESATURASE
    8e-17  10%  2v3jA1 [c.116.1.6] ESSENTIAL FOR MITOTIC GROWTH 1 A:23 -- 251
    2e-16  12%  1d6jA  [c.37.1.4] ADENOSINE-5'PHOSPHOSULFATE KINASE
    4e-16  14%  1atrA1 [c.55.1.1] HEAT-SHOCK COGNATE 70 KD PROTEIN A:2 -- 188
    6e-16  12%  1s9hA  [c.37.1.20] REP 40 PROTEIN
    6e-16  19%  1f2t.1 [c.37.1.12] RAD50 ABC-ATPASE A:- -- - B:- -- -
    8e-16  11%  1xbtA1 [c.37.1.24] THYMIDINE KINASE, CYTOSOLIC A:18 -- 150
    1e-15  12%  2axpA1 [c.37.1.1] HYPOTHETICAL PROTEIN BSU20280 A:2 -- 165
    1e-15  14%  1fl9A  [c.37.1.18] HYPOTHETICAL PROTEIN HI0065
    1e-15  14%  1t3wA  [a.236.1.1] DNA PRIMASE
    1e-15  11%  1jb1A  [c.91.1.2] HPRK PROTEIN
    3e-15  12%  1f46A  [d.129.4.1] CELL DIVISION PROTEIN ZIPA
    4e-15  13%  1bs2A1 [a.27.1.1] PROTEIN (ARGINYL-TRNA SYNTHETASE) A:484 -- 607
    4e-15  15%  1g6oA  [c.37.1.11] CAG-ALPHA
    5e-15  14%  1dhyA1 [d.32.1.3] 2,3-DIHYDROXYBIPHENYL 1,2-DIOXYGENASE A:1 -- 132
    6e-15  15%  1e3mA2 [c.37.1.12] DNA MISMATCH REPAIR PROTEIN MUTS A:567 -- 800
    6e-15  15%  1vhhA  [d.65.1.2] SONIC HEDGEHOG
    9e-15  11%  1i1qA  [d.161.1.1] ANTHRANILATE SYNTHASE COMPONENT I
    1e-14   8%  1tljA  [d.282.1.1] HYPOTHETICAL UPF0130 PROTEIN SSO0622
    1e-14  12%  2vgmA3 [d.79.3.2] DOM34 A:278 -- 381
    1e-14  11%  1dnpA2 [c.28.1.1] DNA PHOTOLYASE A:1 -- 200
    1e-14  10%  1zs3A1 [a.25.1.1] LACTOCOCCUS LACTIS MG1363 DPSA A:3 -- 173
    2e-14  13%  1tmkA  [c.37.1.1] THYMIDYLATE KINASE
    3e-14  11%  1mm8A  [c.55.3.4] TN5 TRANSPOSASE
    5e-14  14%  1ak2A1 [c.37.1.1] ADENYLATE KINASE ISOENZYME-2 A:14 -- 146 A:177 --
    6e-14  14%  1g8yA  [c.37.1.11] REGULATORY PROTEIN REPA
    1e-13  16%  1cr0A  [c.37.1.11] DNA PRIMASE/HELICASE
    1e-13   9%  1j1zA2 [d.210.1.1] ARGININOSUCCINATE SYNTHETASE A:171 -- 395
    2e-13  10%  1ohcA1 [c.45.1.1] CDC14B2 PHOSPHATASE A:42 -- 198
    4e-13   8%  1grqA  [c.37.1.3] CHLORAMPHENICOL 3-O PHOSPHOTRANSFERASE
    5e-13  11%  2qgmA1 [c.150.1.3] SUCCINOGLYCAN BIOSYNTHESIS PROTEIN A:33 -- 445
    1e-12  13%  1rkbA  [c.37.1.1] PROTEIN AD-004
    1e-12   8%  2vnuD1 [b.40.4.5] EXOSOME COMPLEX EXONUCLEASE RRP44 D:400 -- 494
    1e-12  11%  1ni3A1 [c.37.1.8] YCHF GTP-BINDING PROTEIN A:11 -- 306
    2e-12  14%  1v47A1 [b.122.1.3] ATP SULFURYLASE A:4 -- 135
    2e-12  11%  1l3aA  [d.18.1.2] P24: PLANT TRANSCRIPTIONAL REGULATOR PBF-2
    2e-12  12%  1poiA  [c.124.1.2] GLUTACONATE COENZYME A-TRANSFERASE
    3e-12  11%  2pa7A1 [b.82.1.1] DTDP-6-DEOXY-3,4-KETO-HEXULOSE ISOMERASE A:2 --
    5e-12  15%  1ii8.1 [c.37.1.12] RAD50 ABC-ATPASE A:- -- - B:- -- -
    5e-12   6%  1qhdA1 [a.115.1.2] VIRAL CAPSID VP6 A:1 -- 148 A:333 -- 397
    6e-12   6%  2gk3A1 [c.23.16.9] PUTATIVE CYTOPLASMIC PROTEIN A:8 -- 253
    6e-12  15%  1jbkA  [c.37.1.20] CLPB PROTEIN
    7e-12  10%  3cddA1 [b.106.1.1] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN A:181 -- 348
    7e-12   9%  1mi8A  [b.86.1.2] DNAB INTEIN
    9e-12  14%  1ovmA2 [c.36.1.5] INDOLE-3-PYRUVATE DECARBOXYLASE A:3 -- 180
    1e-11  10%  1b77A2 [d.131.1.2] PROTEIN (SLIDING CLAMP) A:111 -- 228
    1e-11  11%  1em8A  [c.128.1.1] DNA POLYMERASE III CHI SUBUNIT
    1e-11   9%  1sbxA  [a.6.1.4] SKI ONCOGENE
    1e-11  11%  1np6A  [c.37.1.10] MOLYBDOPTERIN-GUANINE DINUCLEOTIDE BIOSYNTHESIS
    1e-11   9%  2gtlM1 [b.61.7.1] HEMOGLOBIN LINKER CHAIN L1 M:102 -- 225
    2e-11  10%  3cddA2 [b.106.1.1] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN A:2 -- 180
    2e-11  10%  1viaA  [c.37.1.2] SHIKIMATE KINASE
    3e-11  17%  2ancF1 [c.37.1.1] GUANYLATE KINASE F:3 -- 206
    3e-11  10%  1ckvA  [d.137.1.1] PROTEIN (PROTEIN B)
    5e-11  11%  1yr6A1 [c.37.1.10] ATP(GTP)BINDING PROTEIN A:1 -- 244
    1e-10   7%  1iqrA2 [c.28.1.1] PHOTOLYASE A:2 -- 171
    1e-10  11%  1lw7A2 [c.37.1.1] TRANSCRIPTIONAL REGULATOR NADR A:220 -- 411
    2e-10  12%  2fggA1 [d.50.5.1] HYPOTHETICAL PROTEIN RV2632C/MT2708 A:4 -- 87
    3e-10  20%  2je6I3 [d.51.1.1] EXOSOME COMPLEX RNA-BINDING PROTEIN 1 I:153 --
    5e-10  15%  1uouA3 [d.41.3.1] THYMIDINE PHOSPHORYLASE A:374 -- 480
    8e-10   8%  1es6A2 [b.31.1.1] MATRIX PROTEIN VP40 A:201 -- 321
    1e-09   7%  1f8xA  [c.23.14.1] NUCLEOSIDE 2-DEOXYRIBOSYLTRANSFERASE
    1e-09  12%  1l7lA  [b.18.1.16] PA-I GALACTOPHILIC LECTIN
    2e-09  12%  2f9hA1 [b.161.1.1] PTS SYSTEM, IIA COMPONENT A:3 -- 123
    2e-09  11%  1yj5A2 [c.37.1.1] 5' POLYNUCLEOTIDE KINASE-3' PHOSPHATASE A:351 --
    4e-09   9%  1g8fA3 [c.37.1.15] SULFATE ADENYLYLTRANSFERASE A:390 -- 511
    2e-08  11%  1yvuA2 [c.55.3.10] HYPOTHETICAL PROTEIN AQ_1447 A:315 -- 706
    3e-08  15%  1dwmA  [d.40.1.1] LINUM USITATISSINUM TRYPSIN INHIBITOR
    6e-08   6%  1xl3C1 [a.243.1.1] PROTEIN TYPE A C:2 -- 92
    8e-08  12%  1g31A  [b.35.1.1] GP31
    1e-07  10%  1a4iA2 [c.58.1.2] METHYLENETETRAHYDROFOLATE DEHYDROGENASE / A:2 --
    1e-07  17%  2gujA1 [b.106.1.3] PHAGE-LIKE ELEMENT PBSX PROTEIN XKDM A:5 -- 143
    1e-07  12%  1oa8A  [b.145.1.1] ATAXIN-1
    1e-07  13%  1bccF  [f.27.1.1] UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
    2e-07  12%  1zbsA1 [c.55.1.5] HYPOTHETICAL PROTEIN PG1100 A:108 -- 283
    3e-07   7%  1jqjA3 [d.131.1.1] DNA POLYMERASE III, BETA CHAIN A:245 -- 366
    3e-07  14%  1tueA  [c.37.1.20] REPLICATION PROTEIN E1
    3e-07  13%  1o7d.2 [b.30.5.6] LYSOSOMAL ALPHA-MANNOSIDASE C:488 -- 585 D:603 --
    3e-07  13%  1esmA  [c.37.1.6] PANTOTHENATE KINASE
    4e-07  12%  1d8jA  [a.4.5.18] GENERAL TRANSCRIPTION FACTOR TFIIE-BETA
    5e-06  17%  1j90A  [c.37.1.1] DEOXYRIBONUCLEOSIDE KINASE
    5e-06   9%  1gm5A1 [a.24.21.1] RECG A:7 -- 105
    5e-05  13%  1e2hA  [c.37.1.1] THYMIDINE KINASE
    7e-05  16%  1q3tA  [c.37.1.1] CYTIDYLATE KINASE
    8e-05  14%  1v37A  [c.60.1.1] PHOSPHOGLYCERATE MUTASE
    1e-04   4%  1l1oA  [b.40.4.3] REPLICATION PROTEIN A 14 KDA SUBUNIT
    1e-04   9%  1puoA2 [a.101.1.1] MAJOR ALLERGEN I POLYPEPTIDE, FUSED CHAIN 2, A:5
    2e-04  15%  1t9hA2 [c.37.1.8] PROBABLE GTPASE ENGC A:68 -- 298
    2e-04  19%  1odfA  [c.37.1.6] HYPOTHETICAL 33.3 KDA PROTEIN IN ADE3-SER2
    2e-04  16%  1w1wA  [c.37.1.12] STRUCTURAL MAINTENANCE OF CHROMOSOME 1
    2e-04  17%  1tf7A1 [c.37.1.11] KAIC A:14 -- 255
    2e-04  11%  1pgsA2 [b.121.1.1] PEPTIDE-N(4)-(N-ACETYL-BETA-D-GLUCOSAMINYL)
    5e-04  15%  1xkpA1 [a.243.1.3] PUTATIVE MEMBRANE-BOUND YOP TARGETING PROTEIN
    7e-04  14%  1iioA  [a.39.4.1] CONSERVED HYPOTHETICAL PROTEIN MTH865
:253

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MALLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGL
1b0uA           --KLHVIDLHKRYGGHEVLKGVSLQARAGDVISIIGSSGSGKSTFLRCINFLEKPSEGAIIVNGQNINLV
1ji0A           --VLEVQSLHVYYGAIHAIKGIDLKVPRGQIVTLIGANGAGKTTTLSAIAGLVRAQKGKIIFNGQDITNK
1q3hA           --LEKVSFSHLCLVGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGRVSFCS
1l7vC           ----QLQDVAEST----RLGPLSGEVRAGEILHLVGPNGAGKSTLLARXAGXT-SGKGSIQFAGQPLEAW
1sgwA           -SKLEIRDLSVGYDKP-VLERITMTIEKGNVVNFHGPNGIGKTTLLKTISTYLKPLKGEIIYNGVPITKV
1e69A           ---------KLYLKGFKSFGRPSLIGFSDRVTAIVGPNGSGKSNIIDAIKWVFGEKFDMIFAGSENLPPA
1pf4A1          ---VDVKDVTFTYKEKPALSHVSFSIPQGKTVALVGRSGSGKSTIANLFTRFYDVDSGSICLDGHDVRDY
1m3eA1          ---------------YTDAVEAVKDIPNGATVLVGGFGLCGIPENLIGALLKTGVKELTAVSNNAGVDNF
1ex6A           ------------------------------PIVISGPSGTGKSTLLKKLFAEYPDSFGFSVSSTTRTPRA
1g6hA           MEILRTENIVKYFGEFKALDGVSISVNKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFENKDITNK
1e9rA           ---GKLKRMTREKAKQVTVAGVPMPRDAEPHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDML
1nijA1          --------------------------NPIAVTLLTGFLGAGKTTLLRHILNEQHGYKIAVIENEFGEVSV
1bmfA3          PGIIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKKKLYCIY
1mukA           --------RRHSYSSFSKLLEAYLLVKW-----RMCEAREPSVDLRPLCAGI-DPLNSDPFLKMVSVGPM
1t06A           -----------------TVMQELEALGKERTKKIYISNGAHEPVFGVATGAMKPIAKKIKLNQELAEELY
2gx8A1          ---------------------------------AGHIGNYSHCTFSSEGTGTFVPQQLEVRIE-TIIPAS
1pv4A3          ----LFENLTPLHALTARVLDLASPIGRGQRGLIVAPPKAGKTXLLQNIAQSIAYNHPDCVLXVLLIDER
1bgxT2          ----------------------------------------------RGMLPLFEPKGRVLLVDG------
1khbA1          ------------LAEHMLVLGITNPEGEKKYLAAAFPSACGKTNLAMMNPSLPGWKVECVGDDIAWMKFD
2iqhA1          YDKEEIRRIWRQALTHMMIWHSNLNDATYQRTRALVRTG-MDPRMCSLMQGSTLPRRSGA--AGAAVKGV
1vplA           ---VVVKDLRKRIGKKEILKGISFEIEEGEIFGLIGPNGAGKTTTLRIISTLIKPSSGIVTVFGKNVVEE
1qhlA           ---GKFRSLT--LINWNGFFARTFDLDELVT-TLSGGNGAGKSTTMAAFVTALIPDLTLLLHGKL-----
1mjgM           TRGIKLTKIKLDLPINFGPAFEGESIRKGDMYVEMGGNRTPAFELVRTVSESEITDGK-IEVIGPDIDQI
1c4oA1          ----RYRGPSPKGDQPKAIAGLVEALRGERFVTLLGATGTGKTVTMAKVIEALGRPALVLAPNKILAAQL
1n25A           ----------------------VYNIPKKRYWLFKGPIDSGKTTLAAALLELCGGKALNVN-LPLDRLNF
1ffhA2          --------------------ARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQRP
1zp6A1          ----------------------------GNILLLSGHPGSGKSTIAEALANLPGVPKVHFHSDDL-----
1urjA           -------DPDRALLYLVVTEGFKEAVCINNTFLHLG--GSDKVTIGGAEVHRIPVYPLQLFMPDFSRVIA
1kgdA           ----------------------------RKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRPPEE
1jjvA           ----------------------------TYIVGLTGGIGSGKTTIANLFTDLGVPLVDADVVAREVV---
1jalA1          ----------------------------GFKCGIVGLPNVGKSTLFNALTKAGPFCTIEPNTGVVPMPDP
2yyeA2          ----------------------QSGAQVGQLLILTKPIGTGILIKGLKEGILKEEDINEAIENMLALND-
1e6cA           ------------------------------PIFMVGARGCGMTTVGRELARALGYEFVDTDIFMQHTSGM
1udwA           ---------------------------EPFLIGVSGGTASGKSSVCAKIVQLLQKQVVILSQDSFYRVLT
1cd5A           AGQVSFKHVVTFNMEYVGLPKEHPESYYSFMHRNFFDHVDIPAENINLLNGNAPDIDAECRQYEEKIRSY
1afrA           --------------PREVHVQVTHSMPPQKIEIFKSLDNWAEENILVHLKPVEKCWQPQDFLPDPASDGF
2v3jA1          -------------------PVLTSKDKITKRXIVVLAXASLETHKIYVLLNCD-DHQGLLKKXGRDISEA
1d6jA           ------------ASALTRSERTELRNQRGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHA---YRLDGD
1atrA1          -------------------KGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGD
1s9hA           --ILELNGYDPQYAASVFLGWATKKFGKRNTIWLFGPATTGKTNIAEAIAHTVPFYGCVNWTNENFPFN-
1f2t.1          ---------------------------------IIGQNGSGKSSLLDAILGLYWPLRIKDIKKDEFTKDG
1xbtA1          ---------------------------RGQIQVILGPMFSGKSTELMRRVRRFQIAQYKCLVIKYAKDTR
2axpA1          ---------------------------------LEGPDCCFKSTVAAKLSKELKYPIIKGSSFELAKSGN
1fl9A           TQYIPDEFSMLRFGKKFAEILLKLHTEKAIMVYLNGDLGAGKTTLTRGMLQGIGHQGNVKSPTY------
1t3wA           -----------------------------------------KRTTXRILIGLQNPELATLVPPL------
1jb1A           -----------------SXHGVLVDI-YGLGVLITGDSGVGKSETALELVQRGHRLIADDRVDVYQQ---
1f46A           -------------------------------------------IIMNVAAHHGSELNGELLLNS------
1bs2A1          ----------------------------------------------------------------------
1g6oA           SFFEEQGFYNLLDNKEQAISAIKDGIAIGKNVIVCGGTGSGKTTYIKSIXEFIPKEERIISIEDTEEIVF
1dhyA1          ----------------------------------------------------------------------
1e3mA2          --GIRITEGRHPVLNEPFIANPLNLSPQRRXLIITGPNXGGKSTYXRQTALIALXAYIGSYVPAQKVEIG
1vhhA           ----------------------------------------------------------------------
1i1qA           TKVDRYSYVMHLVSRVELRHDLDALHAYRACMNMGTLSGAPKVRAMQLIADAEGQRRGSY----------
1tljA           --------LVWEELREKALNKIYHDKEIGYLDPDILGFLLAFYRNRNDVYTQSSCSGRITIV--------
2vgmA3          ----------------------------------------------------------------------
1dnpA2          ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
1tmkA           ---------------------------RGKLILIEGLDRTGKTTQCNILYKKLQPNCKLLK---------
1mm8A           ----------------------------------------------------------------------
1ak2A1          ----------------------------GVRAVLLGPPGAGKGTQAPKLAKNFCVC--HLATGDMLRAMV
1g8yA           -ATHKPINILEAFAAPPPLDYVLPNMVAGTVGALVSPGGAGKSML-------------ALQLAAQIAGGP
1cr0A           -HLSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAML----
1j1zA2          ----------------------------------------------------------------------
1ohcA1          ------------------------------------------------------DPQDDVYLDITDRLCF
1grqA           ----------------------------TRMIILNGGSSAGKSGIVRCLQSVLPEPWLAFGVDSLIEAMP
2qgmA1          ----------------------------------------------------------------------
1rkbA           ---------------------------------LTGTPGVGKTTLGKELASKSGLK--YINVGDLAREE-
2vnuD1          --RIRTRRAAELLDKRIVISIDSWPTTLGHFVRDLGTIESAQAETEALLLEHDVE---------------
1ni3A1          -------------------KVQWGRPGNNLKTGIVGXPNVGKSTFFRAITKSVLGNPANYPYATIDPEEA
1v47A1          ----------------------------------------------------------------------
1l3aA           --------------------------------------------------------VGYSIYKGKAALTV
1poiA           -----------------LKDAIAKYVHSGDHIALGGFTTDRKAAVFEILRQGITDLTGLGGAAGGDWDML
2pa7A1          ----------------------------------------------------------------------
1ii8.1          MKLERV-----TVKNFRSHSDTVVEFKEGINL-IIGQNGSGKSSLLDAILVGLYWPLRIKDIKKDEF---
1qhdA1          ------------DNSSEYIENWNLQNRRQRTSVLADASETMLANVTSVR-QEYAIPVGPVFPPGMNWTDL
2gk3A1          ----------------------------------------------------------------------
1jbkA           ---AEQGKLDPVIGRDEEIRRTIQVRRTKNNPVLIGEPGVGKTAIVEGLAQRIINGEVPEGLKGRRVLAL
3cddA1          ----------------------------------------------------------------------
1mi8A           --RVSIKDLLDEKDFIWAINEQTMKLESAKV-SRVFMTGKKLVYILKTRLGRTIKATANHRFLTIDGWKR
1ovmA2          -HVIDSPDICWVGCELNASYAADGYARCKGFAALLTTFGVGELSAMNGIAGSYAEHVPVLHIVGAPGTAA
1b77A2          ------------------VASVITEIKAEDLQQLLR-----VSRGLQIDTIAITNKDGKIVINGYNKVED
1em8A           ----------------------------------------------------------------------
1sbxA           ----------------------------------------------------------------------
1np6A           ----------------------------IPLLAFAAWSGTGKTTLLKKLIPALCARGIRPGLIKH-THHE
2gtlM1          AIVTITAAHRKSFFPLRATLSYELDEHDHTVSTTQLRGFYNFGKRELLLAPLKGQSEGYG-VICDFNLGD
3cddA2          --VLKAGGKITKIGITRSLEAXSGAFDLEXTYKFLGNDAQYKAFIEPIKQGQACT------------VDI
1viaA           ------------------------------NIVFIGFXGSGKSTLARALAKDLDLVFLDSDFLIEQKFNQ
2ancF1          ---------------------------QGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQEAIEQVLATGV
1ckvA           ---AGIMGLKGKDFADQFFADENQVVHESDTVVLVLKKSDEINTFIEEILLTDYKKNVNPTVNVEDRAGY
1yr6A1          -----------------------------MIVVFVGTAGSGKTTLTGEFGRYLEDNYKVAYVNLDTGVKE
1iqrA2          ----------------------------------------------------------------------
1lw7A2          ---------------------------------ILGGESSGKSVLVNKLAAVFNTTSAWEYGREFVFEKL
2fggA1          ----------------------------------------------------------------------
2je6I3          --------------------GIVIDIMPVKVPRVIGKNKSMYETLTSKS--IFVANNGRIWAFSEEILIE
1uouA3          ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1l7lA           --------------------EVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQG
2f9hA1          ----------------------------------------------------------------------
1yj5A2          ----------------------------------VGFPGAGKSTFIQEHLVSAGYVHVNRDTLGSWQRCV
1g8fA3          -------------------------PKQGFSIVLGNSLTVSREQLSIALLSTFLQFGGGRYYKINNKTEL
1yvuA2          ----------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
1xl3C1          ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
2gujA1          --------------------------------------KKGSDPYFTLQAVLDDQSSGRVTLYDVNFDSA
1oa8A           ----------------------------------------------------------------------
1bccF           ---------------------------------------------------------------------L
1zbsA1          ----------------------------------------------------------------------
1jqjA3          -----------------KFRGVRLYVSENQLKITANNPEQEE-----------AEEILDVTYSGAEMEIG
1tueA           -----------------ALKSFLKGTPKKNCLVFCGPANTGKSYFGMSFIHFIQGAVISF-VNSTSHFWL
1o7d.2          ----------------------------------------------------------------------
1esmA           LPLSRLLNFYISSNAVLEQFLGTNGQRIPYIISIAGSVAVGK----------------------------
1d8jA           ----------------------------------------------------------------------
1j90A           ---------------------------QPFTVLIEGNIGSGKTTYLNHFEKCLLTEPVEKWRNVNGVNLL
1gm5A1          ----------------------------------------------------------------------
1e2hA           ---------------------------TLLRVYIDGPHGMGKTTTTQLLRDDIVYVPEPMTYWRV----L
1q3tA           ---------------------------KTIQIAIDGPASSGKSTVAKIIAKDF---GFTYLDTGAMYRAA
1v37A           ----------------------------------------------------------------------
1l1oA           -----------------RINAGMLAQFIDKPVCFVGRLEKIHPTGKM--FILSDGEGKNGTIELMEPLDE
1puoA2          ----------------------------------------------------------------------
1t9hA2          -------------------------------------SGVGKSSLLNAISPTRHVELGGLVADTPGFSSL
1odfA           -----------------------------LFIFFSGPQGSGKSFTSIQIYNHLMEKYGGEKSIGYASIDD
1w1wA           ---------------------------------IIGPNGSGKSNMMDAISFVLGVLKDLIYRGPQSAYVK
1tf7A1          ------------------------------------------------IAKMRTMIEGDDISHGGLPIGR
1pgsA2          -----------------------NTEKAYLRTTISGWGHAKPYDAGSRGCAEWCFRTHTIAINNA---NT
1xkpA1          ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           APHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVLREHAAELMVYVG
1b0uA           RDKDGQLKVADKNQLRLLRTRLTMVFQHFNLWSHMTVLENVMEAPIQVLGLSKHDARERALKYLAKV-GI
1ji0A           PAHVINRXGIALVPEGRRIFPELTVYENLXXGAYNRKDKEGIK---------------RDLEWIFSLFPR
1q3hA           QFSWIMPGTIKENIIFGVSYDEYRYKSVVKACQL--------------------------QQDITKFAEQ
1l7vC           SATKLALHRAYLSQQQTPPFATP---------------------VWHYLTLHQHDKTRTELLNDVAGALA
1sgwA           KGKIFFLPEEIIVPRKISVEDYL------------------------KAVASLYGVKVNKNEIMDALESV
1e69A           GSAYVELVVRLKDIRDRFAGTGLGVDFYSIVGQGQIDRIVNAYQRVNESFNRFISLLFFGGEGRLEISIR
1pf4A1          KLTNLRRHFALVSQNVHLFNDTIANNIAYAAEGEYTREQI-----------EQAARQAHAMEFIENMPQG
1m3eA1          GLGLLLQSKISSYVGENAEFERQYLAGELEVE------------LTPQGTLAERIRAGGAGVPAFYTSTG
1ex6A           GE----VNGKDYNFVSVDEFKSMIKNNEFIEWAQF---------------SGNYYGSTVASVKQVSKSGK
1g6hA           EPAELYHYGIVRTFQTPQPLKEMTVLENLLIGEICPGESPLNSLFYKKWIPKEEEM--VEKAFKILEFLK
1e9rA           SKFGR---DKDIILNPYDQRTKGWSFFNEIRNDYD---------------WQRYALSVVPRGKTDEAEEW
1nijA1          -DDQLIGDRATQIKTLTNGCICCS-RSNELEDALLDLLDNL------------------DKGNIQFDRLV
1bmfA3          VAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQ-----------YLAPYSGCSMGEYFRDNGK
1mukA           LQST--RKYFAQTLFKTVSGLDVNAIDSALLRLRT-------------------LGADKKALTAQLLMVG
1t06A           AT---GNYDAMYFAGIIAD-PKAMSESDFDRWIDGAYFYMLSDYVVAVTLSESNIAQDVAD---------
2gx8A1          LQRKVIKAMVTAHPYEEVAYDVYPLDNKGETLGLGKIGYL------------------QEEMTLGQFAEH
1pv4A3          PEEVTEXQRLVKGE-----VVASTFDEPAS---------------RHVQVAEXVIEKAKRLVEHKKDVII
1bgxT2          ---------HHLAYRTFHALKGLTTSRGEPVQAV----------YGFAKSLLKALKEDGDAVIVVFDAKA
1khbA1          AQGHLRAINPENGFFGVAPGTSVKTNPNAI--------------KTIQKNTIFTNVAETSDGGVYWEGID
2iqhA1          GMVMELIRMIKRGINRRTRIAYERMCNILKGKFQ-------------TAAQRTMVDQVRESRNPGNAEFE
1vplA           PHEVRKLISYLPEEAGAYRNMQGIEYLRFVAGFYASSSSEIEEMVERA-----------------TEIAG
1qhlA           -KAGVCYSMLDTINSRHQRVVKVDIKPFAIQGLPMSVQPTQLVTETLNERQARVLNELKDKLEAMEGVQF
1mjgM           PEGSKLPLGILVDIYGRKMQADFEGVLERRIHDFINYGE-------------------GLWHTGQRNINW
1c4oA1          AAEFRELFPENAVEYFISYYDYYQPEAYV---------PGKDLYIEKDASINPEIERLRHSTTR-----S
1n25A           ELGVAIDQFLVVFEDVKGTGGESRDLPSGQGINNLDNLRDYLDGSVKVNLEKKHL----NKRTQIFPPGI
1ffhA2          AAREQLRLLGEKVGVPVLEVMDGESPESIRR---------------------------------RVEEKA
1zp6A1          WGYIKHGRIDPWLPQSHQQNRXIXQIAADVAGRYAK----------EGYFVILDGVVRPDWLPAFTALAR
1urjA           EPANHRSIGEKFTYPLPFFNRPLNRLLFEAVVGPAAVA----LRSRNVDAVARAAAHL--AFDENHEGAA
1kgdA           NGKNYYFVSHDQMMQDISNNEYL------------------------EYGSHEDAMYGTKLETIRKIHEQ
1jjvA           AKDSPLLSKIVEHFGAQILNRAALRERVFN----------------------------HDEDKLWLNNLL
1jalA1          RLDA--LAEIVKPERILPTTMEFVDIAGLVAGASKGEGLGNKFLA--------------NIRETDAIGHV
2yyeA2          KARNLMLSLDATACTDVTGFGLLGHAWNICKNSNIGARIFFEK-------VPYYQLSENLVKKKIYPKGA
1e6cA           TVADVVEGWPGFRRRESEALQAVATPNRVVATGGGMVLLEQNRQFMRAHGTV------VYLFAPAEELAL
1udwA           SEQKAKALKGQFNFDHPDAFDNELILKTLKEITEGKTVQIPVYDFVSHSRKEETV---------------
1cd5A           GKIHLFMGGVGNDGHIAFNEPASSLASRTRIKTLTHDTRVANSRFQVPKYALTVGVGTLLDAEEVMILVL
1afrA           DEQTMLNTLDGVRDETGASPTSWAIWTRAWTAEENRHGDLLNKYLYLSGRVDMRQIEKTIQYLIGSGM--
2v3jA1          RPDITHQCLLTLLDSPINKAGKLQ---------------VYIQTSRGILIEVNPTVRIPRTFKRFSGLXV
1d6jA           NIRFGLNKDLGFSEADRNENIRRIAEVAKLFADSNS----------------------IAITSFISPYRK
1atrA1          AAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPEEVSSMVLTKMKEIAEAYLGKT
1s9hA           ---DCVDKMVIWWEEGKMTAKVVESAKAILGGSKVRVDQ-------------------KCKSSAQIDPTP
1f2t.1          TKYRITRRFLKGEIHAMKRLVGISAFMEKLIPYNIFLNAIYIRQFAEFTEGKYSEVVVRAEENKVRLFVV
1xbtA1          ALPACLLRDVAQEALGVAVIGIDEGQFFPD------------------------IVEFCEAMANAGKTVI
2axpA1          EKLFEHFNKL---ADEDNVIIDRFVYSNLVYAKKFKDYSILTERQLRFI-EDKIKAKAKVVYLHADPSVI
1fl9A           -TLVEEYNIAGKMIYHFDLYRLADPEELEFMG----IRDYFNTDSICLIEWSEKGQGILPEADILVNIDY
1t3wA           --ENLDENKLPGLGLFRELVNTCLSQPGLTTGQLL----------------EHYRGTNNAATLEKLSXWD
1jb1A           -DEQTIVGAAPPILSHLLEIRGLGIIDVXNLFGAGAVREDTTISLIVH------------LENWTPDQLI
1f46A           ------IQQAGFIFGDMNIYHRHLSPDGSGPALFSLANMVKPGTF-------------DPEMKDFTTPGV
1bs2A1          ----------------------------------------------------------------------
1g6oA           KHH----KNYTQLFFGGNITSADCLKSCLRXRPDRIILGELRSSEAY----DFYNVLCSGHKGTLT----
1dhyA1          -------------------------------------------------SIER----LGYLGFAVKDVPA
1e3mA2          PIDRIFTRVGFXVEXTETANILHNATEYSLV---------LXDEIGRGTSTYDGLSLAWACAENLANKIK
1vhhA           -------------------------------------------------------LAYKQFIPNVAKTLG
1i1qA           ------GGAVGYFTAHGDLDTCIVIRSALVENGIA---------------TVQAGAGIVLDSVPQSEADE
1tljA           -DAEMPWDRKNSTIIF--KNHLRITEQDLEDVLSKNQVRRLWLIVQGPIIHIYAKNIETGWD-----ILK
2vgmA3          ----------------------------------------------------------------------
1dnpA2          -----------------------------------------------RQDLRLHDNLAAACRNSSARVLA
1zs3A1          -----KELDKAEIDHHKPTAGAMLVLSNLFIE---NIRLTQAGIYAKSPVK----------CEYLREIAQ
1tmkA           ---------FPERSTRIGGLINEYLTDDSFQLSDQAIHLLFSANRWEIVDKIKKDL--LEGKNIVMDRYV
1mm8A           ------ADWAKSVFSSAALGDPRRTARLVNVAAQLAKYSGK--------SITISSEGSKAAQEGAYRFIR
1ak2A1          ASGSELGKKLKATMDAGKLVSDEMVLELIEKNLE----------TPPCKNGFLLDGFPRTVRQAEMLDDL
1g8yA           DLLEVGELPTGPVIYLPAEDPPTAIHHRLHALGA-----------------HLSAEERQAVADGLLIQPL
1cr0A           ------EESVEETAEDLIGLHNRV---------RLRQSDSLKREIIENGKFDQWFDELFGN---------
1j1zA2          ----------------------YSMDANLLHISYEGGVLEDPWAEPPKGMFRMTQD--PEEAPDAPEYVE
1ohcA1          AIYSRPKSASNVHYFSIDNELEYENFYADFGPLNLAMVYRY-----------------CCKINKKLKSIT
1grqA           LKMQSAEGGI---EFDADGGVSIGPEFRALEG--------------------AWAEGVVAMARAGARIII
2qgmA1          ----------------------------------------------------------QSVQKNIVK--S
1rkbA           QLYDGYDEEYDCPILDEDRVVDELDNQMREGGVIVDYHG---------CDFFPERWFHIVFVLRTDTNVL
2vnuD1          ----------------------------------------------------------------------
1ni3A1          KVAVPDERFDWLCEAYKPKSRVPAFLTVFDIAGLTSTGVGLGNAFLS--HVRAVDAIYQVV---------
1v47A1          ----------------------------------------------------------------------
1l3aA           EPRS--PEFSPLDSGAFKLSREGMVMLQFAPA------------AGVRQYDWSRKQVFSLSVTEIGSIIS
1poiA           IGNGRVKAYICYTANSGVTNVSRRFRKWFEAG----------KLTMEDYSQDVIYMMWHAAALGLPFLLM
2pa7A1          --------------------------------------------------------------------EP
1ii8.1          ------EKVKKYKALAREAALSKIGELASEIFAE--------FTEGKYSEVVVRAEENKVRLFVVWEGKE
1qhdA1          ITN---YSPSREDNLQRVF-TVASIRSMLV----------------------------------------
2gk3A1          ----------------------LFIGESWHIHXIHSKGYDSFTSSKYEEGATWLLECLRKGGVDIDYX-P
1jbkA           DMGALVAGAKYRGEFEERLKGVLNDLAKQEGNVILFIDELHTMVG-------------AMDAGNMLKPAL
3cddA1          ---------------------------------------------------KAGVS--LILGDNVKAARG
1mi8A           LDELSLKEHIALPRKSDISWD-SIVSITETGVEEV-----------------------------------
1ovmA2          QQR---GELLHHTLGDGEFRHFYHMSEPITVAQAVLTEQNACYEI-----DRVLTTMLRER---------
1b77A2          SGLTRPKYSLTLTDYDGSNFNFVINMANMKIQPGN---------------YKVMLWGAGDKVAAKFESSQ
1em8A           ----------------------------------------------------------------------
1sbxA           ----------------------------------------------------------------------
1np6A           LRKAGAAQTIVASQQRWALMTETPDEEELDLQFLASRMDTSKLDLILVEG--------------------
2gtlM1          DDHADCVPSSLFVCAH------------------------------------------------------
3cddA2          GGERVITGYVDDWVPSYDESTITISVSGRDKTADLVDCSIDYPSGQFNNQTLTQIADIVCKPFGIKVIVN
1viaA           KVSEIFEQKRENFFREQEQKXADFFSSCEKACIATGGGFV----NVSNLEKAGFCIYLKADFEYLKKRLD
2ancF1          DVFLDIDWQGAQQIRQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEMSHYAEYDY--
1ckvA           WWIKANSELLGRQFNVYDFLVDVS-STIGRAY--------------------------------------
1yr6A1          LPYEPSIDVREFVTVEEIMREGYGPNGAIV----------------------------------------
1iqrA2          --------------------------------------------------HRGDLLHDHPALLEALARGP
1lw7A2          GGDEQ-AMQYSDYPQXALGHQ-----------------------RYIDYAVRHSHKIAFIDTDFITTQAF
2fggA1          ----------------------------------------------------------VGKTCQIDVLIE
2je6I3          AIRKIENESHIK----------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
1es6A2          ---------------------GISFHPKL---------RPILLPNKNSADLTSPEK--IQAIMTSLQDFK
1f8xA           ----------------------------------------------------------------------
1l7lA           LICH--DAFCGALVMK----IGNSGTIPV-----------------NTGLFRWVAPNNVQGAITLIYNDV
2f9hA1          -----IGKHAIDDSEKXIILFGETATDTLKQHAVIQ---------------SFPEKDQVTLAEGDHLKIG
1yj5A2          SSCQAALRQGKRVVIDNTNPDVPSRARYIQCAKDAGVPCRCFNFCATIEQARHNNRFREXTDPSHAPV--
1g8fA3          LSLIQDFIGSGSGLI--IPDQWEDDKDSVVGKQNVYLLDTSSSADIQLESADEPISHIVQKVVLFLEDNG
1yvuA2          ---------------------------------------------------------------------K
1dwmA           ----------------------------------------------------------------------
1xl3C1          ---------------------------------SEFMGDIVALVDXRWAGIHDIEHLANAFSLPVRFYQD
1g31A           ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
2gujA1          KIASLDEEEVPFTFED------------------------------------------------------
1oa8A           --------------------MKGSIIQLAN--GELKKVEDLKTEDFIQSAEISND---LKIDSSTVERIE
1bccF           EGIRKWYYNAA-GFNKYGLMRDDTIYENDDVKEA---------------IRRLPENLYDDRMFRIKRALD
1zbsA1          ---------------------------------------------LGTGSNSCLFD--GREIKANVS--P
1jqjA3          FNVSYVLDVLNALKCE-NVRMMLTDSVSSVQI--------------------------------------
1tueA           EPLTDTKVAMLDDATTTCWTYFDTYMRNALDGNPISIDP-------------------------------
1o7d.2          ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------KFGVLAKIVNYMKTRHQRGDTHPL
1j90A           ELMYKDPKKWAMPFQSYVTLTMLQSHTAPTNKKLKIMERSIFSARYCFVENMRRNGSLEQ----------
1gm5A1          ---------------------WGEALPTLLEE-------------FLNEVEKMLKNQVN--TRRIHQLLK
1e2hA           GASETIANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPPPALTLIFDRH
1q3tA           TYMALKNQLGVEEVEALLALLDQHPIQLVFVGDVDITHPIRENEVTNHVSAIAAIPEVREKLVSLQQEIA
1v37A           ----------------------------------------------------------LLRARRTAELAG
1l1oA           EISGIVEVGRVTAKATILCTSYV-----------------------------------------------
1puoA2          ---FFAVANGNELLLDLSLTKVATEPERTAMK-------------KIQDCYVENGL--ISRVLDGLVMTT
1t9hA2          EFTDIEEEELGYTFPDIREKSSSCKFRGCLHLKE---------------PKCAVKQAVED--------GE
1odfA           FYLT----------HEDQLKLNEQFKNNKLLGLPGTHDMKLLQEVL--------NTIFNQDTVVLPKY--
1w1wA           AFYQKGNKLVGKTVSYKDYSIFLENENILIKAKNFLVFQGDVEQIAAQSPVELSRMFTFDYVSDHLDAIY
1tf7A1          STLVSGTSGTGKTLFSIQFLYN-GIIEFDEPGVFVTFEETPQDIIKNARSFGWDLAKLVDEGKLFILDAS
1pgsA2          FQHQLGALGCSANPIN-NQSPGNWTPDRA-----------------------------------------
1xkpA1          ----------------------------------------------------------------------
1iioA           ---------------------------------------------------------------------G


                         +         .         .         .         .         *         .:210
query           LEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEIDNLVRKIADSGITVVLVEHD
1b0uA           DERAQGKYPVHLSGGQQQRVSIARALAMEPDVLLFDEPTSALDPELVGEVLRIMQQLAEEGKTMVVVTHE
1ji0A           LKERLKQLGGTLSGGEQQXLAIGRALXSRPKLLXXDEPSLGLAPILVSEVFEVIQKINQEGTTILLVEQN
1q3hA           DNTVLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCK-LMANKTRILVTS
1l7vC           LDDKLGRSTNQLSGGEWQRVRLAAVVLQAGQLLLLDEPXNSLDVAQQSALDKILSALCQQGLAIVXSSHD
1sgwA           EVLDLKKKLGELSQGTIRRVQLASTLLVNAEIYVLDDPVVAIDEDSKHKVLKSILEILEKGIVIISSREE
1e69A           KPGRRDQKLSLLSGGEKALVGLALLFALPSPFYVLDEVDSPLDDYNAERFKRLLKENSK-HTQFIVITHN
1pf4A1          LDTVIGENGTSLSGGQRQRVAIARALLRDAPVLILDEATSALDTESERAIQAALDELQKNK-TVLVIAHR
1m3eA1          YGTLVQEGGSPIKYNKDGSIAIASKPREVREFNGQHFILEEAIRGDFALVKAWKAD-QAGNVTFRKSARN
1ex6A           TCILDIDMQGVKSVKAIPELNARFLFIAPPSVEDLKKRLEGRGTETEESINKRLSAAQAGAHDKVIVNDD
1g6hA           LSHLYDRKAGELSGGQMKLVEIGRALMTNPKMIVMDEPIAGVAPGLAHDIFNHVLELKAKGITFLIIEHR
1e9rA           ASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASALTSARFVLSDK
1nijA1          IECTGMADPGPIIQTFFSHEVLCQRYLLDGVIALVDAVHADEQMNQFTIA---QSQVGYADRILLTKTDV
1bmfA3          HALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDAFGGGSLTALPVIE-TQA
1mukA           LESEADALAGKIMLQDVNTVQLARVVNLAVPDTWMSLDFDSMFKHHVKLLPKDGRH---------LNTDI
1t06A           -------KWIASGDELKMSAGWSWLLGNRKDNAFSESKISDMLEMVKDTIHHSPETKSAMNNFLNTVVPL
2gx8A1          VKQSLDVKGARVVGKLDDKVRKVAVLGGDGNKYINQAKFKGADVYVTGDYYHVAHDAMMLGLNIVDPGHN
1pv4A3          LLDSI------TRLARAYNTVVPAVLTGGVDANALHRPKRFFGAARNVEEGGSLT-----IIATALIDTG
1bgxT2          PSFRHEAYGGYKAGRAPTPEDFPRQLALIKELDLLGLARLEVPGYEADDVLASLAKKAEKGYEVRILTAD
1khbA1          EPLASGVTITSWKNKEWSSEDGEPCAHPNSRFCTPASQCPIIDAAWESPEGVPIEGIIFGGRRPAGVPLV
2iqhA1          DLIFLARSALILRGSVAHKSCLPACVYGSAVASGYDFEREGYSLVGIDPFRLLQNSQ------VYSLIRP
1vplA           LGEKIKDRVSTYSKGMVRKLLIARALMVNPRLAILDEPTSGLDVLNAREVRKILKQASQEGLTILVSSHN
1qhlA           KQFNSITDYHSLMFDLGIIARRLRSASDRSKFYRLIEAYGGISSAITRSLRDYLLP--------------
1mjgM           LRVSKDAVAKGFRFKNYGEILVAKMKEEFPAIVDRVQVTIFTDEAKVKEYMEVAREKYKDDRMRGLTDET
1c4oA1          LLTRRDVIVVASVSAIYGLGDPREYRARNLVGFVLFPATHYLSPEGLEEILKEIEKELWERVRYFEERGE
1n25A           VTMNEYSVPKTLQARFVKQIDFRPKDYLKHCLERSEFLLEKRIIQSGIALLMLIWYRPVAEFAQSIQSRI
1ffhA2          RLEARDLILVDTAGRLQIDEPLMGELARLKEVLGPDEVLLVLDAMTGQEALSVARAFDEKGVTGLVLTKL
1zp6A1          PLHYIVLRTTAAEAIERCLDRGGDSLSDPLVVADLHSQFADLGAFEHHVLPVSGKDTDQALQSAINALQS
1urjA           LPADITFTAFAGGFEQRLASVMAGDAALASMAVFDEPPTDISAQDTAAARANAVGAYLA-RAAGLVGAMV
1kgdA           GLIAILDVEPQALKVLRTAEFAPFVVFIAAPTITPGLNEDESLQRLQKESDIL-QRTYAHYFDLTIINNE
1jjvA           HPAIRERMKQKLAEQTAPYTLFVVPLLIENKLTALCDRILVVDVSPQTQLARSANFEQ--IQRIMNSQVS
1jalA1          VRCFENIDPLDDIDTINTELALADLDSCERAIQRLQKRAKGGDKEAKFELSVMEKILPLENAGMIRSVGL
2yyeA2          IENLNFVKNYLKSNLDNWKLILLSDPVTSGGLLFTINKEK------LEKIDETAKELEVNYWIIGETIAE
1e6cA           RLQASLQAHQRPTLTGRPIAEEMEAVLREREALYQDVAHYVVDA--TQPPAAIVCEL-------------
1udwA           ----------TVYPADVVLFEGILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQ
1cd5A           GSQKALALQAAVEGCVNHMWTISCLQLHPKAIMVCDEPSTMELKVKTLRYFNELEAENIKGL--------
1afrA           --DPRTENSPYLGFIYTSFQERATFISHGNTARQAKEHGDIKLAQICGTIAA------DEKRHETAYTKI
2v3jA1          QLLHKLSIRSEEKLLKVIKNPITDHLPTKCRKVTLSFDAPVIRVQDYIEKLDDDESIC--VFVGAXARGK
1d6jA           DRDTARQLHEVATPGEETGLPFVEVYVDVPVEAPYEAPANPEVHVKNYEVKQIIDYLDTKGY---LPAK-
1atrA1          VTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAA-----------------------------
1s9hA           VIVTSNTNMCAVIDGNSTTFEHQQPLQDRMFKFELTRRLDHDFGKVTKQEVKDFFRWAKDHVVEVEHEFY
1f2t.1          WEGKFLSGGERIALGLAFRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKKIPQVILVSHD
1xbtA1          VAALDGTFQRKPFGAILNLVPLAESV--------------------------------------------
2axpA1          KKRLRVRGDEYIEGKDIDILELYREVXSNAGLHTYSWDTGQWSSDEIAK---------------------
1fl9A           YDDARNIELIA---QTNLGKNIISAFS-------------------------------------------
1t3wA           DIADKNIAE--QTFTDSLNHXFDSLLELRQEELIARERTHGLSNEERLELWTLNQELA------------
1jb1A           FDVPVPKITVPVKVGRNLAIIIEVAAXNFRAKSXGYDATKTFEKNLNHLIEH------------------
1f46A           TIFMQVPSYGDELQLFKLMLQSAQHIADEVGGVVLDDQRRMMTPQKLREYQDIIREVKDAN---------
1bs2A1          TGPYLQYAHSRLRSVERNASGITQEKWINADFSLLKEPAAKLLIRLLGQYPDVLRNAIKTHEPTTVVTYL
1g6oA           -----------TLHAGSSEEAFIRLAAARKFESLIEGFKDL--------IDXIVHINHHKQCDEFYIK--
1dhyA1          WDHFLTKSVGLMAAGSAGDAALYRADQRAWRIAVQPGELDDLAYAGLEVDAALERMADKLRQAGVAFTRG
1e3mA2          ----------ALTLFATHYFEL-TQLPEKXEGVANVHLDALEHGDTIAFXHSVQDGAASYGLAVAVPKEV
1vhhA           ASGRY--EGKITRNSERFKELTPNYN---PDIIFKDEENTGADRLMTQRCKDKLNALAISWPGVKLRVTE
1i1qA           TRNKAR--------AVLRAIATAH----------------------------------------------
1tljA           IAREAGFKHSGILATNQKGVLVELRTGIRMVHLLRESNTERVDKDKIKTLVNVCNEVLARGKQKMNLLKD
2vgmA3          -----------KAWYGEKEVVKAAEYGAISYLLLTDKVLHSDNIAQREEYLKLMDSVESNGGKALVLSTL
1dnpA2          LYIATPRQWATHNMSPRQAELINAQLNGLQIALAEGIPLLFREVDDFVASVEIVKQVCAESVTHLFYNYQ
1zs3A1          REVEYFFKISDLLLDENEIVPSTTEEFLKYHKFITEDPKAKYWTDE-DLLESFIVDFQAQNMF---ITRA
1tmkA           YSGVAYSAAKGTNGMDLDWCLQPDVGLLKPDLTLFLSTQFGDERYETVKFQEKVKQT--------FMKLL
1mm8A           NPNVSAE--AIRKAGAMQTVKLAQ----EFPELLAIEDTTSLSYRHQVAEE-LGKLGSIQDKSRGWWVHS
1ak2A1          MEKRKEKLDSVIEFSIPDSLLIRRITGRLIHSDDNKKALKIRLEAYHTQTTPLVEYYSKRIHSAIDASQT
1g8yA           IGSLPNIMAPEWFDGLKRAAEGRRLMVLDTLRRFHIEEENASGPMAQVIGRMEAIAADTGCSIVFLHHAV
1cr0A           DTFHLYDSFAEAETDRLLAKLAYMRSGLGCDVIILDHISI---RKMIDNLMTKLKGFASTGVVLVVICHD
1j1zA2          VE-FFEGDPVAVNGERLSPAALLQR----LNEIGGRHGVGRVDIVENRFVGMKSRGVYETPGTILYHARR
1ohcA1          MLR--KKIVHFTGSDQRKQANAAFLVGCYMVIYLGRTPEEAYRILIFGETSYIPFRDANFYITLLDCFHA
1grqA           DDVFLGGAAAQERWRSFVGDLDVLWVGVRCDGAVAEGRETARGDRVAGMAAKQAYVVEGVEYDVEVDTTH
2qgmA1          IQSQANPLKTIEPSKPFEDLKPLKKXIGNAQYVGLGENTHGSSEIFTXKFRLVKYLVTEXGFTNFAXEED
1rkbA           YERLETRGYNEKKLTDNIQCEIFQVLYEEATASYKEEIVHQLPSNKPEELENNVDQILKW-IEQWIKDH-
2vnuD1          ----------------------------------------------------------------------
1ni3A1          -----------RAFDDAEIIHVEGDVDPIRDLSIIVDELLIKDAEFVEKHLEGLRKITSRGA--------
1v47A1          ----------------LPALEIGEDERLDL-ENLATGAFFPVKGFMTREEALSVAHEGEVWTIPILLQFR
1l3aA           LGTDSCEFFHDPNKGRSDEGRVRKVLKVEP---LPDGSGHFFNLSVQNKLINLDEN-----IYIPVTKAE
1poiA           QGSGLTDEWGISKEVRKTLDKVPDDKFKYIDNPFKP----------------------------------
2pa7A1          RGFHAHKKLEQVLVCLNGSCRVILDDGNIIQEITLDSPAVGLYVG--PAVWHEMHDFSSDCVMMVLASDY
1ii8.1          RPLTFLSGGERIALGLAFRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKKIPQVILVSHD
1qhdA1          ----------------------------------------------------------------------
2gk3A1          AHTVQIAFPESIDELNRYDVIVISDIGSNTFLLQNETFYQL---KIKPNALESIKEYVKNGGGLLXIGGY
1jbkA           ARGELHCVGATTLDEYRQYIEKDAALERRFQKVFVAEPSVEDTIA-------------------------
3cddA1          RFSWRQRFSKFTIKAAKADVTDSEIGRYRPLIIVNEEVTAEGAAKRGQWQRSIGKSNXAEYTVTGWRIPQ
1mi8A           ----------------------------------------------------------------------
1ovmA2          ----------------------------------------------------------------------
1b77A2          VYVIAMEADSTHDF--------------------------------------------------------
1em8A           ----------------------------NATFYLLDNDTTVDGLSAVEQVCEIAAERWRSGKRVLIACED
1sbxA           -----------RCETVLEGETISCFVVGGEKRLCLPQILNSVL--RDFSLQQINAVCDELHIYCSRCTAD
1np6A           -----------FKHEEIAKIVLFRDGAGHRPEELVIDRHVIAVASDVPLDVALLDINDVEGLADFVVEWM
2gtlM1          ----------------------------------------------------------------------
3cddA2          TDVGEPFQRIQIEQGETPHELLARLA-KQRGVLLTSDTFGNLVI--------------------------
1viaA           KDEISKRPLFYDEIKAKKLYNERLSKYEQKANFILNIENKNIDE-LLSEIKKVIK---------------
2ancF1          ---LIVNDDFDTALTDLKTIIRAERLRMSRQKQRHDALISK-----------------------------
1ckvA           ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1iqrA2          VVGLVVLDPNNLKTTPRRRAWFLENVR------ALREAYRARGGALWVLEGLPWEAARRLKAKAVYALTS
1lw7A2          CI---------QYEGKAHPFLDSXIKEYPFDVTILLKNNTE--QKQRQQFQQLLKKLLD-----------
2fggA1          EHDERTRAKARLSWAGRQXVGVGLAR-----LDPADEPVAQIGDE--LAIARALS---DLANQLFALTSS
2je6I3          ----------------------------------------------------------------------
1uouA3          -------------------------------------------AREQEELAPADGTVLVRALPLALVLHE
1es6A2          IVPIDPT--KNIMGIEVPETLVLKLTGGQPIIPVLLPKYIGLDPVAPGDLTMVITQDCDTCHSPASL---
1f8xA           --------AGWFTDRQNKAYKEAMEALKENPTIDLENSYVPLDNQYKGIRVDEHPEYLHDKVWATATYNN
1l7lA           PG-----TYGNNSGSFSVNIGKDQS---------------------------------------------
2f9hA1          DTNYTITKVGSFANSNLQSIAHSTLIFADAPTDEDDVIRNG------VYLTPHQLPKITIGTTIDYL---
1yj5A2          ----------SDXVXFSYRKQFEPPTLAEGFLEILEIPFRLQEHLD-PALQRLYRQFSE-----------
1g8fA3          FFVF------------------------------------------------------------------
1yvuA2          VDAFVGIDISRITRDGKTVNAVAFTKIFNSKGELVRYY--------LTSYPAFGEKLTEKAIGDVFSLLE
1dwmA           ------------------------------------------------MAAATVERENRNVHAIVLKEGS
1xl3C1          LXRMFRLFPLGVFSDEEQRQNLLQMCQNAIDMA-------------------------------------
1g31A           ----------------------LPIRAVGEYVILVSEPAQAGDEEVTESGLIIGKRVGEVPELCVVHSV-
1a4iA2          -----------------------------PAEILNGKEIS---AQIRARLKNQVTQLEQVPGFTPRLAIL
2gujA1          ----------------------------------------------------------------------
1oa8A           DSHSPGVAVIQFAVGEHRAQVSVEVLVEYP-FFVFGQGWSSCCPERTSQLFDLPCSKLSVGDVCISLTL-
1bccF           LNMRQQILPK---EQWTKYEEDVPYLEPYLKEV-------------------------------------
1zbsA1          LGYILGDEGSGAVLGRLFIGSLLKGQ---XPEGLCEAFLQEYGLTSADIIESVYRKPFPN--RFLAGFSP
1jqjA3          ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
1o7d.2          ------------------VDWMVRLPVSKHVYLVKDPGGKIVPSDVVTIPSSDSQEL-LFSALVPAVGFS
1esmA           -----------YSHLIYDVIPDGDKTVVQPDILILEGLNVLQSGXDYPHDPHHVFVSDFVDFSIYVDAPE
1d8jA           TLDEILDETQHLDIGLKQKQWLMTEAVNNPKIEVIDGKYAFKPKY-------------------------
1j90A           ----------------------------------------------------------------------
1gm5A1          ELDDPLLENKDLEEKLQAFLDYVK------EIPNLPEARKRYRIQKSLEMIEKLRSWFLIDY--------
1e2hA           PIAALLCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLARQRPGERLDLAMLAAI
1q3tA           QQGGIVMDGRDIGTVVLPQAELKIFLVASVDERA------------------------------------
1v37A           FSPRLYPELREIHFGALEGALWETLDPRYKEALLRFQGFHPPGGESLSAFQERVFRFEGLKAPAVLFTHG
1l1oA           ----------------------------------------------------------------------
1puoA2          ISSSK-----------------------------------------------------------------
1t9hA2          LKQYRYDHYVEFMTEIKDRKP-------------------------------------------------
1odfA           --------DKSQFKGEGDRCPTGQKIKLPVDIFILEGWFLGFNPILQGIENNDL----------------
1w1wA           RELTGNASLEYLSGGEKTVAALALLFAYQPPFFVLDEVDAALDITNVQRIAAYIRRHRNPDLQFIVISLK
1tf7A1          PDPEGQEVVGGFDLSALIERINYAIQKYRARRVSIDSVTSVFQQYDARELFRLVARLKQIGATTVMTTER
1pgsA2          ----------------------------------------------------------------------
1xkpA1          ---------------------FXMLCGLRDALXGRPELAHLSHL----VEQALVSMAEEQGETIVLGARI
1iioA           PDTTCKSGDVELKASDAGQVLTADDFPFKAEEVADTIVKAG-----------------------------


                         .         .         .         +         .         .         .:280
query           MKMVMNISDRILVLNYGRKLTEGSARDVRDNPEVIAAYLGTAA
1b0uA           MGFARHVSSHVIFLHQGKIEEEGDPEQVFGNPQSLQQFLK---
1ji0A           ALGALKVAHYGYVLETGQIVLEGKASELLDNEXVRKAYLGVA-
1q3hA           KMEHLRKADKILILHQGSSYFYGTFSELSLRPDFSSKLMG---
1l7vC           LNHTLRHAHRAWLLKGGKXLASGRREEVLTPPNLAQAY-----
1sgwA           ----LSYCDVNENLHKY--------------------------
1e69A           KIVME-AADLLHGV-----------------------------
1pf4A1          L-STIEQADEILVVDEGEIIERGRHAD----------------
1m3eA1          FNLPXCKAAETTVVEVEEIVDIGSFAPEDIHI-----------
1ex6A           LDKAYKELKDFIFAE----------------------------
1g6hA           LDIVLNYIDHLYVMFNGQIIAEGRGKNVLSDPKVVEIYIG---
1e9rA           LPEHVTMPDGDFSIRSWLEDPNG--------------------
1nijA1          AGEAEKLHERLARINARAPVYTVTLGLLFNTNMLEENVVS---
1bmfA3          GDVSAYIPTNVISITDGQIFLETELFYKGIRPAINV-------
1mukA           PPRMGWLRAILRFLGAGMVMTATG-------------------
1t06A           HEKAVEIAKEVGIVEVKRDNKKSS---LLNASESIQKELDRG-
2gx8A1          VEMKQGVQKQLQEKVDAKKLNVHIHASLHTDP-----------
1pv4A3          SKXDEVIYEEFKGTGNXELHLSRKIAEKRVFPAI---------
1bgxT2          KDLYQLLSDRIHVLHPEGYLITP--------AWLWEKY-----
1khbA1          YEAL--SWQHGVFVGAAM-------------------------
2iqhA1          NENPAHKSQLVWMACHSAAFEDLRVSSFIRGTKVVPRG-----
1vplA           MLEVEFLCDRIALIHNGTIVETGTVEELKERYKAIEEVFE---
1qhlA           -------------------------------------------
1mjgM           VDTFYSAPNHVCIVTPERVGLCGAVSWLDAKASY---------
1c4oA1          VLYAQRL------------------------------------
1n25A           VEWKERLDKEFSLSVYQKMKFN---------------------
1ffhA2          DGDAGGAALSARHVTGKPIYFAGLEPFYPE--RLAGRILG---
1zp6A1          GRFRI--------------------------------------
1urjA           FSTNSALHLTEVDD-----------------------------
1kgdA           IDETIRHLEEAVEL-----------------------------
1jjvA           QQERLKWADDVINNDAELAQNLPHLQQKVLEL-----------
1jalA1          DKEELQAIKSYNFLTLKPTMYIANVNEDGFENNPYLDRV----
2yyeA2          NVLEV--------------------------------------
1e6cA           -------------------------------------------
1udwA           YITFVKPAFEEFCLPTKKYADVIIPRGADNLVAI---------
1cd5A           -------------------------------------------
1afrA           VEKLFEIDPDGTVLAFADMMRKKISMP----------------
2v3jA1          DNFADEYVDEKVGLSNY-PLSASVAC-----------------
1d6jA           -------------------------------------------
1atrA1          -------------------------------------------
1s9hA           VK-----------------------------------------
1f2t.1          EE-LKDAADHVIRIS----------------------------
1xbtA1          -------------------------------------------
2axpA1          -------------------------------------------
1fl9A           -------------------------------------------
1t3wA           -------------------------------------------
1jb1A           -------------------------------------------
1f46A           -------------------------------------------
1bs2A1          FKLTH---QVSSCYDVLWVAGQTEELATARLALYGAA------
1g6oA           -------------------------------------------
1dhyA1          DEALM--QQRKVMGLLCLQDPFGLPLEIYYGPIFHEPFLP---
1e3mA2          IKRARQKLREL--------------------------------
1vhhA           GWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAG
1i1qA           -------------------------------------------
1tljA           -------------------------------------------
2vgmA3          HSLGEELDQLTGIACILK-------------------------
1dnpA2          YEVNERARDVEVERALRNVVCEGFDDSVILPPGAVMTGNHEMY
1zs3A1          IKLANKEEKFALAAGV-----VELYGYNLQVIRNLAGDLGKSV
1tmkA           DKEIRKGDESITIVDVTNKGIQEVEALIW---QIVEPVLS---
1mm8A           VLLLEATTFRTVGLLHQEWWMRPDDPADADEKE----------
1ak2A1          PDVVFASILAAF-------------------------------
1g8yA           LVDNIRWQSYLSSMTSAEAEEWGVDDDQRRFFVRFGV------
1cr0A           LRALRQLSDTIIALERNQLVLVRILKCRFTGDTGIAGYM----
1j1zA2          AVESLTLDREVLHQRDMLSPKYAELVYYGFWYAPEREAL----
1ohcA1          VKKAMQYG-----------------------------------
1grqA           KE-SIECAWAIA-------------------------------
2qgmA1          WGNGLKLNEYIQTGKGN--------------------------
1rkbA           -------------------------------------------
2vnuD1          -------------------------------------------
1ni3A1          -------------------------------------------
1v47A1          EKPRVGPGNTVALLHGGERVALL--------------------
1l3aA           FAVLVSAFNFVMPYLLGW-------------------------
1poiA           -------------------------------------------
2pa7A1          YDETDYIRQYDNFKKYIAKI-----------------------
1ii8.1          EELKD-AADHVIRISLENGSSKV---------EVVS-------
1qhdA1          -------------------------------------------
2gk3A1          LSFXIEAKANYKNTVLAEVLPVIXLDGDD--------------
1jbkA           -------------------------------------------
3cddA1          TGKLWNINTLVPVIDEI--------------------------
1mi8A           -------------------------------------------
1ovmA2          -------------------------------------------
1b77A2          -------------------------------------------
1em8A           EKQAYRLDEALWARPAESFVPHNLAGEGPRG------------
1sbxA           QLEILKVXGILPFSPSCGLITKTDAERLCNAL-----------
1np6A           Q------------------------------------------
2gtlM1          -------------------------------------------
3cddA2          -------------------------------------------
1viaA           -------------------------------------------
2ancF1          -------------------------------------------
1ckvA           -------------------------------------------
1yr6A1          -------------------------------------------
1iqrA2          HTPYGRYRDGRVR------------------------------
1lw7A2          -------------------------------------------
2fggA1          DIEAS--------------------------------------
2je6I3          -------------------------------------------
1uouA3          LGALRLGVGAELLVDVGQRLRRGTPWLRVHRDGPQSRALQ---
1es6A2          -------------------------------------------
1f8xA           DLNGIKTNDIMLGVYIPDEEDVGLGMELGYALSQ---------
1l7lA           -------------------------------------------
2f9hA1          -------------------------------------------
1yj5A2          -------------------------------------------
1g8fA3          -------------------------------------------
1yvuA2          KLGFKK-GSKIVVHR-DGRLYRDEVAAFKKYGEL---------
1dwmA           AMTKDFRCDRVWVIVNDHGVVTSVPH-----------------
1xl3C1          -------------------------------------------
1g31A           ---GPDVPEGFCEVGDLTSLPVG--------------------
1a4iA2          QVGNRDDSNLYINVKLKAAEEIGIKATHIKLP-----------
2gujA1          -------------------------------------------
1oa8A           -------------------------------------------
1bccF           -------------------------------------------
1zbsA1          FIAQHLDIPAVYSLVQN--------------------------
1jqjA3          -------------------------------------------
1tueA           -------------------------------------------
1o7d.2          IYS-VSQMPRDLVIQNEY-------------------------
1esmA           DLLQTWYINRFLKFREGAFTDPDSYFHNYAKL-----------
1d8jA           -------------------------------------------
1j90A           -------------------------------------------
1gm5A1          -------------------------------------------
1e2hA           RRVYGLLANTVRYLQCGGSWREDWGQLSGPRPHIGDTLF----
1q3tA           -------------------------------------------
1v37A           G------------------------------------------
1l1oA           -------------------------------------------
1puoA2          -------------------------------------------
1t9hA2          -------------------------------------------
1odfA           -------------------------------------------
1w1wA           -NTMFEKSDALV-------------------------------
1tf7A1          IEEYGPIARYGV-------------------------------
1pgsA2          -------------------------------------------
1xkpA1          TPEAYRESQSGVNPLQPLRDTQGIYAIWS--------------
1iioA           -------------------------------------------